SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013696 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013696
Domain Number 1 Region: 34-211
Classification Level Classification E-value
Superfamily EF-hand 3.5e-48
Family Calmodulin-like 0.000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013696   Gene: ENSTNIG00000010772   Transcript: ENSTNIT00000013890
Sequence length 215
Comment pep:novel chromosome:TETRAODON8:7:7351439:7355158:1 gene:ENSTNIG00000010772 transcript:ENSTNIT00000013890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVVGTLTMQAKQRRPSRDKVDDELEMTTVCHRPEGLEQLEAQTNFSKQELQILYRGFK
NECPSGVVNEETFKHIYAQFFPHGDASMYAHYLFNAFDTSNNGSIKFKDFVTGLSILLRG
TVREKLEWTFHLYDINRDGYINREEMTEIVRAIYDMMGKYTYPALKGDVPQQHVDAFFQK
MDKNKDGVVTLEEFIIACQEDETMMRSMQLFENVM
Download sequence
Identical sequences H3CZL0
ENSTNIP00000013696 ENSTNIP00000013696 99883.ENSTNIP00000013696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]