SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014547 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014547
Domain Number 1 Region: 308-483
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-45
Family CRAL/TRIO domain 0.000039
Further Details:      
 
Domain Number 2 Region: 218-300
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.31e-20
Family CRAL/TRIO N-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 510-663
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.01e-16
Family Supernatant protein factor (SPF), C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014547   Gene: ENSTNIG00000011597   Transcript: ENSTNIT00000014746
Sequence length 703
Comment pep:novel chromosome:TETRAODON8:Un_random:7067990:7075722:-1 gene:ENSTNIG00000011597 transcript:ENSTNIT00000014746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATTMVQEYQSPVRVYKRPFELIMAAYMRRFPKCPLIPVFVDSEVFSENHSDDGAVTVTER
RCVIDIDAPRLLKRIAGVDYLYFIQKNTLNRRDRTLQIEVHNETFSSRVVVRECCNYTVH
PENEDWTCFEQTASLDIKSFFGFESTAEKIAMKQYASSIKKGKEIIEYYLKELEEEGVTY
IPRWSPPVVCSTAKAIPVKASKAGRDSKDHAQTTELVVGTPDDKLDADYIRRYLGDLTPL
QESCFIRLRQWLQENHKGKIPKEQHVLRFLRARDFNLDKARELLCHSLTWRKQHKVDFLL
DAWERPQLLQDYYSGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEVLLRQVLSINEEG
LRRCEENTRVFGRPISCWTCLVDMEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLI
LRVPRVFPVLWTLVSPLIDENTRKKFLIFAGNDYQGPGGLVDYMDKEIIPDFLGGECMCD
VPEGGLVPKSLYRTAEELESEETCLLTDSIYKSASIFKGAPFEMVIEITEASSVITWDFD
VSKGDVIFTIYHSRRAPQVPKKDTLGPHTLTSIGTVNSQVIDKNWMLGRDYSMVERALAC
NEGESVQGSHVTRWPGFYILQWRFHSPPAGTASSIRVDDVLALQVSSHKCKVMYYTEVLA
SHDFRCSVGGPMTSLESCHSGFSQLSAATTASSQSHASSSISR
Download sequence
Identical sequences H3D209
ENSTNIP00000014547 99883.ENSTNIP00000014547 ENSTNIP00000014547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]