SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015408 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015408
Domain Number 1 Region: 121-299
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.32e-49
Family CRAL/TRIO domain 0.0000408
Further Details:      
 
Domain Number 2 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.75e-19
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015408   Gene: ENSTNIG00000012437   Transcript: ENSTNIT00000015613
Sequence length 343
Comment pep:novel chromosome:TETRAODON8:9:10106456:10107998:-1 gene:ENSTNIG00000012437 transcript:ENSTNIT00000015613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHESIDLMSTAAVPSMSAEHSWFPGPPPPIYSCSLTPELVAKAREELQEKPEWRLRDVQA
LRDMILKEQPNLRTRLDDSFLLRFLRARKFDYDRALQLLLNYHAAHKAWPEVFKDLKPST
VKHVLDQGFLTVLPHPDPNGRFILCLRPGKWKPNDYPFVDNVRAIYLTLEKLIQPEVTQV
NGIVILADYTGVGMSQASNPGPFLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIK
PFLKEKMAERYILHGSDLRSLHRHVPRSVLPQEYGGTAGQLDMCAWSRLLLDSEEEFIVE
FCQPDPLEGVVFPDSMLFDGERAGGGQDDDTFRGLRSQLYYCY
Download sequence
Identical sequences H3D4H0
ENSTNIP00000015408 99883.ENSTNIP00000015408 ENSTNIP00000015408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]