SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016546 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016546
Domain Number 1 Region: 78-273
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.59e-56
Family CRAL/TRIO domain 0.0000000472
Further Details:      
 
Domain Number 2 Region: 278-388
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.03e-32
Family Supernatant protein factor (SPF), C-terminal domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.29e-20
Family CRAL/TRIO N-terminal domain 0.000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016546   Gene: ENSTNIG00000013550   Transcript: ENSTNIT00000016759
Sequence length 404
Comment pep:novel chromosome:TETRAODON8:4:3887849:3892139:-1 gene:ENSTNIG00000013550 transcript:ENSTNIT00000016759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQDETLAEFRGRIQDILPDLPAQHDHYLLRWLRARNFSVPKAEAMIRKHL
EFRSKMKVDNIISDWTPPEVIEKYVSGGMCGYDREGSPIWYDVIGPLDPKGLLMSASKQD
FMKTKIRHTEMLQRECRRQSEKLGKNIEAITLIYDCEGLGLKHIWKPAIETYGEILTMFE
DNYPEGLKRVFLIKAPKMFPMAYNLIKHFLCEETRQKIIVLGSNWQEVLRTHIEPDQLPV
AYGGNLTDPDGDPRCRTMIKYGGTVPKSYYVQDSVKVRYDNSVTISRGSVFQLEYDVKAP
SSLLRWQFASDGADIGFGVYRRSTRGGGRKVSDMVQVLTSERYNAHLVPEDGCLSCPEPG
VYVLCFDNSYSILQSKRVSYKVEVLPPPEGPLQSPRSRGEQRLQ
Download sequence
Identical sequences H3D7Q5
99883.ENSTNIP00000016546 ENSTNIP00000016546 ENSTNIP00000016546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]