SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016750 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016750
Domain Number 1 Region: 811-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 2 Region: 857-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 328-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 4 Region: 502-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 966-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.0034
Further Details:      
 
Domain Number 6 Region: 918-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 7 Region: 763-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 8 Region: 264-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000115
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 9 Region: 450-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1075-1117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 391-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 12 Region: 1123-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016750
Domain Number - Region: 1018-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000237
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number - Region: 1168-1298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00417
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1561-1761
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016750   Gene: ENSTNIG00000013748   Transcript: ENSTNIT00000016964
Sequence length 1779
Comment pep:novel chromosome:TETRAODON8:13:12399636:12411053:1 gene:ENSTNIG00000013748 transcript:ENSTNIT00000016964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVLQVLTCVRESGAQSGLSLPELNDLCTEGSCYPATGDLLIGRAHQLSSTSTCGLSRPE
PFCIVSHLQEEKKCFVCDSSEAYEEQTEQVGMLVTTFAPNRLKTWQSENGMENVTVQLNL
EAEFHFTHLIMTFKTFRPAAMVIERSADFGKTWQIYRYFAYDCESSFPSVSHGPMKKVDD
VICDSRYSDIEPSTEGEVIFRVLDPAFHIDDPYSPRIQNMLKITNLRVKFTKLHTLGDNL
LDSRIEIKEKYYYAIYDMVVRGNCFCYGHASECAPIEGAGQVREGMVHGHCMCNHNTKGL
NCEQCEDFHHDLPWRPAEGRNTNACKRCNCNQHSDSCHFDMAVYLASGNVSGGVCDSCLH
NTVGNQCEQCRPFYFQHPERDIRDPNICEACDCDPAGSLNGGICDRMTDVRAGLIAGQCR
CKANVEGERCDRCRDAHYGLGDHPEGCKACSCSPLGTLPGGNPCDSETGSCFCKRLVTGR
NCDQCVDEHWGLSNDMSGCRPCDCDLGGAINNQCDQVSGQCVCRDHMFGRRCDQVESGFY
FIGLDHYTYEAEDAKFGPGVTVVPRPHPHDRTPTWTGVGLANVPEGAFLEFSVDNIPFSM
EYDVLIRYEPQLPDQWEEVLMTVMRPGPIRADSRCINTVPDDDNQMISLHPSWRYVVLPR
PVCFESGLNYTVRLSLPLYSALSDVQSPYTLIDSIVLMPHCKNLDIFTSSEGGDSSGGSA
WETFQRYRCLENSQSVVKSPMADICRNYIFSISAMLHQGVKECQCDPQGALSTVCDASGG
QCQCRPNVVGRNCDRCAPATFQFGPNGCRACDCDPRGSLNSFCDQLTGQCLCLPGVSARQ
CDRCLPGHWGFPACHPCFCNGHAEECDALTGRCVDCRDHSAGHACERCLDGYYGDPVLGS
GDYCRPCMCPDGPGSLRQFAGSCYRGDGSQQATCICDTGYKGARCDECSPGYYGNPGEAG
GQCQPCRCNGNIDVLDPGSCDSRSGECLLCLHHSEGPACESCKLGYYGNATLSDCRRCVC
NALGSDPSACPAPNDCHCERSSGQCRCLPNVIGQHCNQCAANTWNMASGGGCEPCSCHPD
HSYGPSCNEISGQCSCRPGFGGRTCSECRELFWGNPEAECHACDCDPRGTAEPQCNKANG
RCVCVEGVSGPRCDVCARGYSGTFPDCQRCHQCFAEWDNVIGQLTNQTHRLVNKVNALKV
SGVSGPYRKTMESMEKSLADVRAVLNQNPAAQPLTEIQELLQQATDLMGALSQRLNQTEQ
TVLQVDDLDSTARAKLDSVVSDTQKLERTVQELLDQVEFMKNSDIRGASDSIKKYFLQSQ
AAEARANASTVEPGSPVETSSDLRRLTEDKMNQTGEEFLLEHTEHAQRLDDLAGELQTLD
LSEISHKVCGSRASGQDSCSSSPCGGLGCVDPEGQPKCGGEGCDGVVTKAGSSLRKAQDT
EQEITNAMEEVEKLSKMVSEAKVKADEARQSAQDVLMKTNRTKQRVDESNEELRTLIKQI
RDFLTQDAADLESVELVANEVLAMQMPTTPAQLQNLTNEIRQKVDELGDVAAILQQSAGD
IQEAERLLEQARRANEEATGVRDSAQKVKEALQEARKAQTAASSAIQQASADIQSTNSLL
SSVESETADAELKLNNATQRLQQLEQDVMQLRDQAQNVSQSKEQTDRDADSIRKIAEEVK
KELDTEIKDKYATVEQLISTKAVGVADAKKRAQLLQQEAKELLLKASEKLQQLKDVEKSY
EDNQRTLEKKAEQLVELEAAVRGLLTEISHKVTVYSTCV
Download sequence
Identical sequences H3D8A9
ENSTNIP00000016750 99883.ENSTNIP00000016750 ENSTNIP00000016750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]