SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016869 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016869
Domain Number 1 Region: 566-757
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-49
Family DBL homology domain (DH-domain) 0.000000022
Further Details:      
 
Domain Number 2 Region: 762-900
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-38
Family Pleckstrin-homology domain (PH domain) 0.000000509
Further Details:      
 
Domain Number 3 Region: 257-394
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000196
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 993-1040
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000666
Family SH3-domain 0.0028
Further Details:      
 
Domain Number 5 Region: 20-166
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000301
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016869   Gene: ENSTNIG00000013865   Transcript: ENSTNIT00000017083
Sequence length 1088
Comment pep:novel chromosome:TETRAODON8:2:11053811:11069426:-1 gene:ENSTNIG00000013865 transcript:ENSTNIT00000017083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLDSAPLCAADIAPELMRQFAFLSGGRGDNGSPIIVFPEFPTFGDITDREFHNVLTYLT
SVPSLSSTDVGFILVIDRRQDRWAAVKGTLLRIAGSFPGNLELVLVLRPTTLLQRTLSDI
FFKFNKDFKMKVPVIMLSSIAELHSYIDRTQLTEDLGGTQEYCHDKWISHRTAIEGFALM
VKKTAQTLQSFGTELAETELPSEVQATTNLLSTHTDKKDQMKEDLLVALGQGSRLLESIN
EPVVRDPDHNMNQDELENMATVQRLLSQLDETERAFDEFWVRHQTKLEQCLQLRHFEHNY
SEVRTQLEQVSEKLLTFSEVGISPAHADHIFAEHTAYEERVNELLDRAASLAQEGEDLVQ
KSHYAQDSIQLKCTEISTISEDVRAGLKARREQLLKAMKLHHALERASKWVDDGIYLLAS
QPVDKCLSHEGAELALQELEGYLNNAQQNQLSDPSTIWTEYEAVLNPQFKDQVEKVFQKQ
LSMQDMFDKRRVSLKKLATKQTRPVQPVAPRPEAFIKSPLSSPGQPSHSSTNTESTKHCR
RRTRQRRVLSLAVTKEHNRHASLSEEEENLAVLRRHVMNELLETERAYVEELLCVLQGYA
SEMDNPAMLPLIPAPLQNKKEVLFGNMSEIYHFHKRTFLRELEQYTDCPELVGRCFLQRM
TDLQIYEKYCHNKPRSESLWRQCSDCAFFQNQECQKKLEHKLGLDSYLLKPVQRITKYQL
LLKEMLKYSKTCEGADDLQEALASILGILKAVNDSMHLIAITGYEGNLSELGKLLMQGSF
SVWTEHKKGHAKVKDLARFKPMQRHLFLHEKALLFCKRREENGEGYEKAPSYSFKHSLSM
SAVGITENAKGDNKKFEIWCKSREEVYIVQAPTADVKTTWVNEIRKVLTTQLEACREASQ
QRSAEPGFPPVCGAATLSPFKSGQRSFKKPEEKKAEPGSTDAMSSFSPKPTGTGWNKTSL
SLDASEEHEGYSSAEDPLHSDTEDGASKKLCAGKYTVKADYEKAGAQELMVKNGETVELI
KQEDDGQWLVRNLSTSKEGTMAVANLMSLIGKSKSCQSLTSSEGSGSGNLSTSSSCSETY
TSFSDIKP
Download sequence
Identical sequences H3D8M8
99883.ENSTNIP00000016869 ENSTNIP00000016869 ENSTNIP00000016869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]