SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017588 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017588
Domain Number 1 Region: 1269-1534
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-55
Family YWTD domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 3033-3291
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-54
Family YWTD domain 0.00000235
Further Details:      
 
Domain Number 3 Region: 3877-4153
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-46
Family YWTD domain 0.00000411
Further Details:      
 
Domain Number 4 Region: 1894-2149
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-45
Family YWTD domain 0.0000168
Further Details:      
 
Domain Number 5 Region: 1584-1839
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-40
Family YWTD domain 0.0000439
Further Details:      
 
Domain Number 6 Region: 204-470
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-39
Family YWTD domain 0.0000746
Further Details:      
 
Domain Number 7 Region: 538-782
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-38
Family YWTD domain 0.00000946
Further Details:      
 
Domain Number 8 Region: 2203-2472
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-35
Family YWTD domain 0.0000394
Further Details:      
 
Domain Number 9 Region: 2939-3025,3284-3345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-23
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 3790-3870,4154-4193
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1173-1261,1527-1579
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 12 Region: 2737-2772
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 13 Region: 851-892
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 14 Region: 3373-3412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 3576-3615
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 16 Region: 892-934
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 17 Region: 2820-2856
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 18 Region: 977-1014
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 19 Region: 3660-3704
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 932-971
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 21 Region: 2778-2812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 22 Region: 1017-1055
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 23 Region: 28-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 3537-3577
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 25 Region: 2696-2731
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 3493-3534
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 27 Region: 3618-3653
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 28 Region: 3454-3491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 29 Region: 1060-1100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 30 Region: 2600-2641
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 2857-2897
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 32 Region: 2908-2949
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 33 Region: 3336-3370
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 3705-3738
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 35 Region: 3743-3782
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 75-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 2560-2601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 38 Region: 1848-1898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 39 Region: 155-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 40 Region: 3417-3455
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 41 Region: 1844-1889,2160-2210,2473-2525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000643
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 42 Region: 2524-2562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 43 Region: 1106-1143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 44 Region: 2659-2690
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 45 Region: 1145-1182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 46 Region: 4388-4424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017588
Domain Number - Region: 123-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000119
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 4244-4278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000213
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4211-4240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000554
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 4279-4313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000695
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 809-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 4315-4353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 491-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00514
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017588   Gene: ENSTNIG00000014562   Transcript: ENSTNIT00000017809
Sequence length 4560
Comment pep:novel chromosome:TETRAODON8:11:7598882:7642680:1 gene:ENSTNIG00000014562 transcript:ENSTNIT00000017809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFCSSLGGGQLCAIIAPSAQILSFSSAPKTCSPKQFVCKDGVTCISKGWRCDREKDCPD
GSDEEPDVCPHSTVARCPPNEYRCGGTEVCIHMSRLCNGVPDCTDGWDEGPHCRELITNC
SLRGCQESCGITPTGSACYCKSGYEIGPDGKACKDFDECSVYGTCSQSCTNTNGGYTCSC
VEGYLPQPDNRSCKAKNVPVDRLPVLLIANSQNIQATSLSGTTVHSLLSTTTKQTTAMDF
LYAEEKVCWIHVGDAPPSTHLKCARIPNLKSFTEERIINISLSLHHVEQMAVDWLTGNFY
FVDDVDDRIFVCDKNGQTCVTLLDQELYNPKGIALDPTVGKVFFTDYGQIPKVERCDMDG
QNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKNRHTIIQGLLIEHLYG
LTVFENYLYATNSDNANMQPKTSVIKINRFNSTDYQVVTRVDKGGALHVYHQRRQPPVRS
HACELDQFGKAGGCSDICLLGNGHKTRTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRP
GVIRGMDMNAKVPDEYMIPIENLMNPRALDFHAESEFIYFADATSYIIGRQKIDGSERDT
IVKEGGIHIVEGIAVDWMADNLYWTDDGPKKTISVARLEKASQTRKTLIEGKITHPRAIV
VDPLNGWMYWTDWEEDPKESKRGRIERAWMDGSNRNMFLSSKTVLWPNGLSLDVPQGILY
WVDAFYDRIEMVYLNSSERKTVYEGQELIHAFGLCHYKHFLFWNEYRSGSIYKLDSTTGT
VTLLRSERPPIFEIRMYDAQQQQAGSNACRVNNGGCSSLCLATPGGRQCGCADDQILDPA
NNTSCKANPSYKPPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPT
DRFKCKNNRCIPLRWLCDGDNDCGNDEDESNTTCSARTCPPNQYSCASGRCIPISWTCDL
DDDCGDRSDEPASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSS
AQFKCNSGRCIPDYWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRMDSLCIP
LRWRCDGDTDCMDLSDEKNCEGVTHMCDPAVKFGCRDSARCISKAWVCDGDSDCEDNSDE
DNCDACKLSHHVCANDSTICLPPEKLCNGADDCPDGSDEKLCDLCSLENGDCSHNCTVAP
GEGVICSCPLGMELGPNNKTCQIQSFCAKHLKCSQRCQQDKFSVKCSCYEGWELEPDMEN
CKSTDPFKPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDK
IYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTT
LLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLT
VDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNT
LAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQPQAPNPCAAKDGKKPCSHLCLINYNQT
FSCACPHLMKLGPDRRNCYEFRQFLLYARQIEIRGVDIDNPYYNYIISFTVPDIDNVTVV
DYDALEHRIYWSDVRTQTIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDAN
KKQINVARLDGSFKNAVIQGLDKPHCLVLHPVLGKLYWTDGDTINMANTDGSNRSILFTN
QKGPVGLSIDFDTEALYWISSGNSTINRCKLDGSGLEVLEGTKGKLTKATALAIMGNTLW
WADQGTDQIGTCDKTDGGNWKVLRNSTSPMMHMKIYNETVQEVFVFPGTNLCSINNGDCS
QLCLPTSPTTRACMCTAGYSLRTGQQSCEGVGSFLLYSVHEGIRGIPLDPSDKSDALVPV
SGTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGN
IYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPERGYLFWTEWGQYPRIERSRL
DGSERAVLVNVSISWPNGISIDYEENLLYWCDARTDKIERINLETGENREVVLASNNMDM
FSVSVFESYIYWSDRTHANGSIKRGSKDNATDSVSLRTGIGVQLKDIKVFNRARQQGTNV
CKVNNGGCEQLCLFRGNGQRTCACAHGMLAEDGCSCRDYDGYLLYSERTILKSVHLSDEN
NLNAPIKPFEDPEHMKNVIALTFDYRGGGGKGANRVFFSDIHFGNIQQISDDGSDRKTVV
ENVGSVEGLAYHRGWDMLYWTSYTTSTITRHTVDQSRWGAVDRHTVVTMSGEDHPRAFVL
DECQSLMFWTNWNEQSPSIMRATLTGSNVIVIIGSDIRTPNGLAIDHRAEKLYFSDATLD
KIERCEYDGTRRYVVLKNEPVHPFGLAVYGDYIFWTDWVRRAVLRANKYTGGDMKLLRAD
IPQQPMGIVAVANDTNSCEFSMCRVNNGGCQDLCLLTSEGRVNCSCRGDRKLLEDSTCSA
LNTTCNVVDGFECGNGDCINYTLTCDGMAHCKDKSDEKQSYCANRVCKKGYRRCVNGRCV
GHGSWCNGRDDCGDNSDEIFCNTTLCTADQFQCRDGSCISNSSKCDQKVDCEDAGDEMNC
TATDCSSYFHLGVKGVTFQKCEFTTLCYAPSWLCDGANDCGDFSDERNCPGSSKEKCPTP
FFACPSGRCIPKSWTCDKENDCENGADEAHCGPLVDKFCSATQFQCANNRCIPQRWVCDG
ADDCGDSSDEDSQCKTKTCSPEAFQCPGSHMCIPQRWKCDGDKDCPDGTDESVKAGCVFN
NTCSSNEFMCQNRQCIPKHFVCDHDNDCGDGSDESQECEYPTCGPKEFRCANGRCLIQSS
WECDGDFDCHDQSDEAPLNPRCGGPANKCNNTAYACSNGNCVNETLLCDRKDDCGDGSDE
LNCFINECLNSKLSGCSQLCEDLKIGFKCRCHPGFRLKDDRKTCIDIDECTTTYPCTQRC
INTHGSFHCLCVEGYHLSPENPTICKSTSDEEPFLIFANRYYLRKLNLDGSNYTLLKQGL
NNAVALDFDYRQQMIYWTDVTTQGSMIRRMYINGSDVQVLHRTSLSNPDGLAVDWVGGNL
YWCDKGRDTIEVSKLNGAYRTVLVNSGLREPRAVAVDVRYGYLYWSDWGDNPHIGRIGMD
GTNRSIIIEEKITWPNGLTLDFVNDRIYWADAREDYIAFASLDGTRRHTILVKDIPHIFA
MSLFEEYIYWTDWETKSINRAHKTLGTNKTVLISTLHRPMDIHIYHPYRQPEVENHPCQM
NNGGCSNLCLISPGGGYQCACPTNFYLAADGKQCLSNCTASQFVCKNDKCIPFWWKCDTE
DDCGDRSDEPADCPEFKCRPGQFQCGTGICTNPAYICDGDNDCHDNSDEANCEPDIHVCL
PSQFKCTSPSRCIPGIFRCNSQDNCGEGEDEKDCPEVTCAPNQFQCAITKRCIPRVWVCD
RDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDASDEPKEECDER
TCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEDKCVPRQCSESEFACTNGRCIAGRWKC
DGDHDCADGSDENGCEVKCDSDQYQCKNSHCIPLRWHCDADPDCLDGSDEEKCDSGVVRH
CPKDEFQCNNTLCKPQGWKCDGEDDCGDNSDENPEECVIFQCPPTRQFRCLNDRVCLPLS
KRCDGVNNCGDNSDELDCQVPPPIPVCQKHEFQCSNGRCISSIFRCNYFNDCEDYGSDEI
NCNKKDTALNDCRSNRTVCGDGDEAHCVVNGTDSFCSCRPGFQTNGRNRCEDKNECLQFG
VCSHMCNNTKGSYKCGCHKYFTKINDTCKADAQRQLLYIADDNEIRSLDPSIPNWRYEQI
FQGDANVRIDAMDIHVKTNRIYWTNWHTGRISSYDLPSASLSPNNNRNRRQTDSRVTNVE
IPDLKMPRGIAVDWVAGNLYWTDSGRDVIEVAQISKTHHRKTLISGMIDEPYAIVVDPQR
GRMYWADWGNHPKIETAAMDGTMRETLVEKNIQWPTGLAVDYFNERLYWADAKLSLICSV
RLNGSDAVVAVNSLRKLRQPFSIDVFEDYVYGVTYINNYVFRVNKFGKGPIENLTTGMNH
ATDIVLYHRYKQPEVNNPCDSKKCEWLCLLSPSGPVCTCPNGHMLNNGTCVETPTPTLSP
IGPPSGPCLVQCLNGGSCFLNAHKQAKCRCQPNYGGDRCEIDQCRDYCKNGGTCTPSPTG
SPTCRCLTGFTGRNCNLHTCKNYCKNGGNCTVSSGNQPTCQCSHDFLGDQCQYRSCEGHC
LNKGKCLQTENGSKLCRCLPQYTGATCEIDKCHYCRDGECIPSNSFTSRGDFTCRCTNGR
VQPSCYTCDTNEYCANGQCSVNPTTRLPQCKCSPGWAGHRCESVATSESTSGSGTASIVI
PVVLLLLLLILLAAGTLFWYRRRMRGAKGFQHQRMTNGAMNVEIGNPAYKIYEGEPDDDA
GELLDADFTLDPDKPTNFTNPVYATLYMGAHNSRNSLASTDENKELLSRGDEEPLVDPLA
Download sequence
Identical sequences H3DAP4
99883.ENSTNIP00000017586 ENSTNIP00000017586 ENSTNIP00000017588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]