SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018422 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018422
Domain Number 1 Region: 75-277
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.22e-54
Family CRAL/TRIO domain 0.0000000696
Further Details:      
 
Domain Number 2 Region: 280-392
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.44e-35
Family Supernatant protein factor (SPF), C-terminal domain 0.00000484
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.16e-23
Family CRAL/TRIO N-terminal domain 0.0000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018422   Gene: ENSTNIG00000015358   Transcript: ENSTNIT00000018648
Sequence length 407
Comment pep:novel chromosome:TETRAODON8:12:3651894:3657952:-1 gene:ENSTNIG00000015358 transcript:ENSTNIT00000018648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQAEALEQFRQRIQDVLPQLPAQHDYFLLRWLRARNFHVQKSEAMLRKHL
EFRKQMKVDTIIADWRPPEVIEKYLSGGMCGYDREGSPIWYDVIGPVDPKGLFLSAPKQD
FIKAKIRECEMLSKECNLQSQRSNQLGRIVESITMIYDVEGLGLKHLWKPAIETFGEILQ
MFEENYPEGLKRLFVIKAPKIFPVAFNLVKHFLSENTRQKIFVLGANWQEVLLKHIDAEE
LPVIYGGKLTDPDGDPRCRTRINHVGPVPPSYYVRDHIHVDYEQCTVVKRGSSQQLDYEI
LVPGCVLRWQFATESADIGFGVFLKERKGERKKATQMREVVPSQRYNAHLVPEDGSLTCQ
QPGVYVLRFDNTYSIFQAKRVSFTVEVLLPDLMPCPEAAGEVGNTPA
Download sequence
Identical sequences H3DD29
99883.ENSTNIP00000018422 ENSTNIP00000018422 ENSTNIP00000018422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]