SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018579 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018579
Domain Number 1 Region: 212-318
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 9.68e-17
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018579   Gene: ENSTNIG00000015508   Transcript: ENSTNIT00000018806
Sequence length 348
Comment pep:novel chromosome:TETRAODON8:1:15972907:15975594:1 gene:ENSTNIG00000015508 transcript:ENSTNIT00000018806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTEATLRMENMEVKDEWQDEDFPRLLPEYGDMDPSCGLTDERASPPNSLNLSPPGGHG
AVPSSHRKRRTLIAPEMNLSLDQSEGSLLSDDFLDTPDDLDINVDDIDTPDETDSLEFIT
NGNELEWEDDTPVASAKAAPPDGLGGADDQGNANGRLWRTVLIGEQEHRIDMQIIRPYLR
VITHGGYYGEGLNAIIVFSACYLPDSSCPDYHYIMENLFLYMVSSLEMLVAEDYLIVYMN
GATPRSKMPGISWLKKCYQMIDRRLRKNLKSLVIAHPTWFIRTVLAISRPFISMKFLNKI
QYVHSLDELAEMVPMEHVHVPDCVLQFDEERIKARKERTAHQAIFFFP
Download sequence
Identical sequences H3DDI6
ENSTNIP00000018579 ENSTNIP00000018579 99883.ENSTNIP00000018579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]