SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018724 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018724
Domain Number 1 Region: 2651-2916
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-71
Family Protein kinases, catalytic subunit 0.00000133
Further Details:      
 
Domain Number 2 Region: 1895-2095
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-51
Family DBL homology domain (DH-domain) 0.000022
Further Details:      
 
Domain Number 3 Region: 1240-1419
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-50
Family DBL homology domain (DH-domain) 0.0000000219
Further Details:      
 
Domain Number 4 Region: 1428-1546
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-32
Family Pleckstrin-homology domain (PH domain) 0.00000275
Further Details:      
 
Domain Number 5 Region: 2092-2209
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-31
Family Pleckstrin-homology domain (PH domain) 0.00038
Further Details:      
 
Domain Number 6 Region: 2547-2641
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-21
Family I set domains 0.0083
Further Details:      
 
Domain Number 7 Region: 249-385
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 8 Region: 806-956
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-17
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 9 Region: 1053-1191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000576
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 10 Region: 507-619
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000353
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 11 Region: 2406-2468
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000477
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 12 Region: 1607-1672
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000111
Family SH3-domain 0.0038
Further Details:      
 
Domain Number 13 Region: 623-730
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000504
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 14 Region: 162-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000157
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 15 Region: 6-154
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000392
Family CRAL/TRIO domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018724
Domain Number - Region: 390-505
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0192
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018724   Gene: ENSTNIG00000015650   Transcript: ENSTNIT00000018951
Sequence length 2961
Comment pep:novel chromosome:TETRAODON8:2:19485799:19533497:-1 gene:ENSTNIG00000015650 transcript:ENSTNIT00000018951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKASDVLPVLKEKVAFVSGGRDKRGGPILTFPARSNHDRIKQEDLRRLVTYLSTVPSEDV
CKRGFTVIIDMRGSKWELIKPLLKTLQEFFPAEICVALIIKPDNFWQKQKTNFGSAKFSF
ETSMVSVEGLAKLVDPSQLTDDFEGSLDYNHEEWMDLRVSLEEFMSNAVHLLSRLEDLQE
LLSKKDFPADVEGSRRLIEEHTQLKKKVLKAPVEELDREGQRLLQCIRSSDGFSGKNCIS
GSADFQSLVPKVASLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHN
KEVFLQSHTEIGRSYQHAVELQTQHNHFTMNSMNAYVNINRIMSVASRLAEAGHYASTQI
KQISGQLDQDWKSFAAALDERSTILAMSSVFHQKAKQFLSEVEAWCKVCSEGGLPSEMQE
LELAIHRHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHCILD
VVHEVLHHQRRLENIWQHRKVRLHQRLQLCVFQQDVQQVIDWIENHGEAFLSKHTGVGKS
LHRARALQKRHDDFEDVAQCVFACRTTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLE
VRIQDFVRRVEHRKLLLDMSVSFHTHTKELWSWMEELQKQLLDDVCCDSVDSVQSLIQQF
QQQQTATLEATLNVIKEGEELIQQLRDAAMSTNKTPHCSSIAHIQGVLQQLDEAQGQMEE
LFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLSRQLSDAGAEDIGLAEQRLKRHAE
RKAAMNNMTYEVMQQGQDLHQYIMEVQASGIELTAEKDMDLASQVQELLEFLHEKQQEVD
LNAQHTHTRLEQTLQLRHLQAEVKQVLGWIRNGESMLNASMVNASSLSEAEQLQREHEQF
QMAIEKTHQSALQVQQKAEMMLQAGHYDPEAIRNCAEKVAVHWQQLMLKMEDRLKLVNAS
VAFYKTSEQVCSVLESLEQEYRRDEDWCGSHDKLGMSSDSDHLLPLISKHLEQKEAFLKA
CTLARRNAEVFLKYIHRNNVSMPGATSHARGPEQQVKAILNELLQRENRVLHFWTLKKRR
LDQCQQFVVFERSAKQQAVDWIQETGEVYLATHTSPGDSSEETQQLLTDYHHFRLSAKQT
KDKVKLLIQLADNLVEKGHVHVTELKRWVSTVDRRYRDFSLRMAKYQESLERSLGVSSEV
NQDTKDLELDIIPASLTDDQAVKLRDPNHEVNEEKRRSARKKEFIMAELLQTEKTYVRDL
QECLETYLWEMTNGVEEIPPGITNKEHIIFGNMQDIYDFHNNIFLKELINYEQLPEDVGH
CFVTWADKFHIYVDYCKNKPDSSQLILEHAGTFFDDIQQRRGLANSISSYLIKPVQRITK
YQLLLKELLSCCEEGKGEIKDGLEVMLGVPKRANDAMHLAMLEGFEENLEVQGELILQDS
FQVWDPRSLIRKGRDRHLFLFEFSLVFSKEIKDSAGRTKYQYKSRLLTSELGVTEHIEGD
PCKFALWAGRTPSSDNKTVLKASSMEAKQEWIKNIREVIQERMTHLKGALKEPLHLPKTP
ALSKPRNNTKREGVEDGDSQGEGSSQPDTVSIASRTSQNTVDSDKLSGGCELTVVLHDFT
AGCSTELSVCTGQTVELLERPSERPGWCLVRTTERTPPQEGLVPSSVLCVSHSRSSVEMD
CFFSSGDLLSLSSRNDFSPEGGKVNCNSSMVGKRGSPGPKRSGNTLRKWLTPPVRRLSQG
SSVKKLPNHKQKKTGTGREESRKSIDLGQPDLPQDDIIDERVIGKDGNILSKAPSGMQSG
GEEEQDEEAHTPLPPPMEIIKDPSAQDEKSSSLLTSMQSSSEVPSAAELVSAIEKLVKTK
MMCDFRPLQTLEPGAYPGFTSLSPPEQTTPVQPRNPELEQRAKAMRGRMFVLNELIQTEK
DYVKDLGIVVEGFMKRIEEKGVPDDMKGKDKIVFGNIHQIYDWHREFFVGELEKCLDDHE
HLPELFIKHERRLHMYVIYCQNKPKSEFIVAEYDTYFDGIQQDIQSRLTISDFLIKPIQR
ITKYQLLLKDFLKFSSKAGMDCEQIEKAVDLMSQVPKLCNDMMNLGRLQGYEGKLTSQGK
LLQQETFFVTEQDAGVLSRSKERRVFLFEQIVIFSELLRKGSSTPGYQFKKSIKVSYLGL
EESVDNDPCKFVLSCRGSSERFTLQAANVDIKQVWVRHIQALLDDQSKFLYALQSPIEYQ
KDKIGAGSSSSLTRNRSSSGNRPAMSNRPSSAVGLGDKGTERGRSQMRASTSNGGSSCFQ
SRVSSWKAPLDSPLHQGPSHFLPGCHFETRLRCSGIHLIKIDLLSSTKKRTAWVRGMAGE
LRLKCLITADVKNRSRRLKWADTCRSSDCSFVHDLPLLLRCWSTVMVLQPSGPLSSNHAE
GSCNGVSSTMRVIEDYSALKENEICVAQGETVQILATNQQNMYLVYRPANVDSPAAEGWV
PGRVLGPLTKSIKKNSPGIFRKSLSWNTLRARKRAEAKDGSSLALRGQENGLLRKSKETT
PPPPLALQSTRAKGKLLNPNFIQEVAPEFLNPLSDVVCAFGETVVLCCKVCGRPKPSITL
KGPDQNPVTSSSRFTVDIRDTGDILLKICNVMPQDTGIYTCVAVNDHGSASSSASIKVQD
AGFDGTGIHWKENFESMFSEICEIGRGRFSVVRKCLNKSTKKEVAVKFVSKKMQKKEQVA
QEADVLLHVQNHQLVALLDTYESPASLMLVLELLEDGRLFDYLVAHDELMEEKVSFFIRE
ILEALQHLHTCRVAHLDLKPENIMVDLHSPTPCIKLIDLGDAVQLSVHRRYVHLLLGNPE
FAAPELVRGTPVSVATDVWSVGVLAYVMLSGVSPFLDESPEETCVNICRLDFCFPDEYFG
DVSQAARDFVSSLLQQDPRKRPSATACLQHPWVVRGGAHGGEYSKKPLDTSRLATFIDRR
KQLHDVRPVTNIKGLVSLGNT
Download sequence
Identical sequences H3DDY1
99883.ENSTNIP00000018724 ENSTNIP00000018724 ENSTNIP00000018724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]