SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018895 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018895
Domain Number 1 Region: 132-261
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.18e-16
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018895   Gene: ENSTNIG00000015812   Transcript: ENSTNIT00000019123
Sequence length 269
Comment pep:novel chromosome:TETRAODON8:12:7120709:7122399:-1 gene:ENSTNIG00000015812 transcript:ENSTNIT00000019123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLKSKPSFLADWPAGSQQNTEWFSPPVDVSLEQSEGSVLSEDALDTEDDGLDTGDDLEVS
TDELDTPEEADLPGQTGGSEEPNLGAGVEPAEAEENGDGGMWRSVTVAEQEHRIDMKSIE
PYKRVISHGGYYTERNAIIVFSACFLPDSNCDNYSYVMENLFLYVINTLELMVAEDYMIV
YLNGATPRRRLPGFTWMKKCYQMIDRRLKKNLKMFIIVHPSWFIRTLLGITRPFISTKFS
SKIKYVNSLQELGQIIPLEYVNIPASIVR
Download sequence
Identical sequences H3DEF2
99883.ENSTNIP00000018895 ENSTNIP00000018895 ENSTNIP00000018895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]