SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019247 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019247
Domain Number 1 Region: 28-160
Classification Level Classification E-value
Superfamily EF-hand 2.41e-23
Family Calmodulin-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019247   Gene: ENSTNIG00000016156   Transcript: ENSTNIT00000019476
Sequence length 221
Comment pep:novel chromosome:TETRAODON8:7:8019441:8029790:-1 gene:ENSTNIG00000016156 transcript:ENSTNIT00000019476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKMPFHHVRAGLLYPDNYLSSSLTEGSEAFQLTSISTEELGEIREAFRVLDRDGNGFISK
QELGMAMRSLGYMPSEVELAIIMQRLDMDGGDGQVDFEEFMTILGPKLLSSDNREGFLGN
TIDNIFWQFDMQQLSLDELKQVLFHAFRDHLTMKDIENIIITEEESLNENSGNCPEYEGV
HPKKKNRQTCVRKSLICAFAMAFIISVMLIAANQMLRNGME
Download sequence
Identical sequences H3DFF3
ENSTNIP00000019247 ENSTNIP00000019247 99883.ENSTNIP00000019247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]