SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019613 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019613
Domain Number 1 Region: 27-268
Classification Level Classification E-value
Superfamily CutC-like 4.32e-80
Family CutC-like 0.00000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019613   Gene: ENSTNIG00000016513   Transcript: ENSTNIT00000019843
Sequence length 272
Comment pep:novel chromosome:TETRAODON8:17:5105196:5108081:1 gene:ENSTNIG00000016513 transcript:ENSTNIT00000019843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVGSGASTQRKQIKRVLCPEGMADSFLMEVCVDSVESAVNAERGGAGRLELCSSLTEGGL
TPSLGLLQVVKEYVKIPVYVMVRPRGGDFLYSDQEVQVMRKDIELMKRHGADGLVLGALT
EDGRVDAELCMELLGAARPLPVTFHRAFDMAHDPVVTLETLVSLGFQRVLTSGCDTSALE
GLPVIKRLVDQAKERILIMPGGGITERNLLRILEGSGAQEFHCSARSSKDSAMKFRNNSV
AMGASFSAPEYSLKVADVSKIRTLNAIARNTL
Download sequence
Identical sequences H3DGG9
ENSTNIP00000019613 ENSTNIP00000019613 99883.ENSTNIP00000019613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]