SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019967 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019967
Domain Number 1 Region: 308-431
Classification Level Classification E-value
Superfamily EF-hand 8.71e-48
Family EF-hand modules in multidomain proteins 0.00001
Further Details:      
 
Domain Number 2 Region: 434-528
Classification Level Classification E-value
Superfamily EF-hand 2.58e-37
Family EF-hand modules in multidomain proteins 0.0000309
Further Details:      
 
Domain Number 3 Region: 510-597
Classification Level Classification E-value
Superfamily RING/U-box 5.06e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 20-153
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000262
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 5 Region: 146-267
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000275
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 270-307
Classification Level Classification E-value
Superfamily WW domain 0.00000000000964
Family WW domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019967   Gene: ENSTNIG00000016854   Transcript: ENSTNIT00000020198
Sequence length 886
Comment pep:novel chromosome:TETRAODON8:1:9151029:9194782:-1 gene:ENSTNIG00000016854 transcript:ENSTNIT00000020198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPGDMNLCWSEIKRKSHNIRVRLEAFSDNSGKLQLSLQEIIEWLTAKDEELSEQLPIGGD
VGAVQHQRKFHQTFMEEVKSRGPFIYSVLESAQAFLAQHPFQEPEETLTDGKDVSPRRRI
LNVSRSVWKQANVASDLWEKLTARCVDRHRHMERTLERLLQIQAAMEELAVALDQAEGVR
DAWEPVGDLFIDSLQDHIDATKLFKEELTQVKEGMKHINDLAHQLAISDVHLSMENARSL
EHLNSRWKVLQGSIEERLKQLQDAHRDFGPGSQHFLSSSVQIPWERAISPNKVPYYINHQ
AQTTCWDHPKMTELYQALADLNNIKFSAYRTAMKLRRVQKALRLDLVALSSLVEVFRDQE
LQQGEHVMDVVEMIHGLTALYERLEEERSILVNIPLCVDMCLNWLLNVYDSARNGKIRVL
SFQMGLVSLCNADVQEKYKYLFRQVSGPGGLSDQRHLSLLLHEAIQIPRQLGEVAAFGGS
NVEPSVRSCFRLAPGKPAIEVSHFLEWMSLEPQSMVWLPVLHRVTAAECTKHQAKCYVCK
QFPIKGFRYRSLKQFNVDICQTCFLTGRSTKGKKLHYPIMEYYTPTTSGEKMRDFAKTLK
NKFRSKQYFTKHPQRGYLPVQSVLEAESSETPCSSPKMPHADTHSRIEHYASRLAEMESQ
NCSFFTDSLSPDESLDEDQYLLRHSSLALDQDSPCGQHMLLAHLEHQNKEQLQCTLARLE
NENRVLQGEYRRLKWKHAEAASVPMLTEAGEAGAGSAEGQQDEELLAEARALRQHKTRLE
TRMQILEDHNKQLESQLRRLRELLLQPKDDSEANGSEPSTLSSPVSGGGHHGEAASRETT
DTEAAGDDMEHEQDTVLQLQEVIEQLRNVFPSEPVQSVSQNTQYCV
Download sequence
Identical sequences H3DHH3
ENSTNIP00000019967 99883.ENSTNIP00000019967 ENSTNIP00000019967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]