SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021319 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021319
Domain Number 1 Region: 178-229
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000000916
Family CRAL/TRIO domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021319   Gene: ENSTNIG00000018153   Transcript: ENSTNIT00000021554
Sequence length 237
Comment pep:novel chromosome:TETRAODON8:Un_random:16083575:16084900:-1 gene:ENSTNIG00000018153 transcript:ENSTNIT00000021554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNSLPLLGSRPRRRKVLVAPALSLSLGGSESMDDFPAAFLSPSPEDEDEGDLDIDLDAME
TPSDSESLLFPALELEDHLQHLGVGASPGSREPGLGALGQEDVVDKEGSRWRCFCPGEPP
QEAWVNMSVLEPFLRVLSHGGYHGDGMNDVIVFSSCFLPENSLENYQYVMDNLFRLRKNL
KGFYVVHPTWYIKALITIIKPFISSKFSRKLRFVETLQELAELVPLEQLQVPACVRQ
Download sequence
Identical sequences H3DLC1
ENSTNIP00000021319 ENSTNIP00000021319 99883.ENSTNIP00000021319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]