SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022257 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022257
Domain Number 1 Region: 2593-2819
Classification Level Classification E-value
Superfamily Plakin repeat 4.58e-80
Family Plakin repeat 0.0000000554
Further Details:      
 
Domain Number 2 Region: 4-174
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.48e-62
Family Calponin-homology domain, CH-domain 0.0000011
Further Details:      
 
Domain Number 3 Region: 2410-2580
Classification Level Classification E-value
Superfamily Plakin repeat 4.05e-55
Family Plakin repeat 0.0000021
Further Details:      
 
Domain Number 4 Region: 4363-4505
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-24
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 3939-4069
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 1114-1295
Classification Level Classification E-value
Superfamily Spectrin repeat 5.34e-20
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 7 Region: 4862-4946
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.02e-20
Family GAS2 domain 0.00052
Further Details:      
 
Domain Number 8 Region: 4132-4288
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-18
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 9 Region: 2318-2407
Classification Level Classification E-value
Superfamily Plakin repeat 7.85e-18
Family Plakin repeat 0.00027
Further Details:      
 
Domain Number 10 Region: 573-675
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 11 Region: 4756-4848
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000367
Family Polcalcin 0.082
Further Details:      
 
Domain Number 12 Region: 269-361
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000662
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 13 Region: 3746-3860
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000768
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 14 Region: 4565-4749
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000024
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 15 Region: 3127-3234
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000681
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 16 Region: 3520-3633
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000528
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 17 Region: 3207-3344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000533
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 18 Region: 2837-2907
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000549
Family Plakin repeat 0.0084
Further Details:      
 
Domain Number 19 Region: 3848-3962
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000864
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 20 Region: 4256-4360
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000048
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 21 Region: 425-571
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000309
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 22 Region: 3628-3743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000547
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 23 Region: 2197-2233
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000968
Family Plakin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022257
Domain Number - Region: 680-762
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00208
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 759-810
Classification Level Classification E-value
Superfamily SH3-domain 0.0607
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022257   Gene: ENSTNIG00000019064   Transcript: ENSTNIT00000022496
Sequence length 4982
Comment pep:novel chromosome:TETRAODON8:8:2368007:2417740:1 gene:ENSTNIG00000019064 transcript:ENSTNIT00000022496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFVDERDRVQKKTFTKWVNKHLIKADRRVDDLYEDLRDGHNLISLLEVLSGERLPREKG
HMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLILGLIWTIILHFQISDIQVNG
QSEDMTAKEKLLLWSQRISDGYQNIRCENFSTSWRDGKLFNAVIHKHYVLETPDTVNNAA
AFIKRKSKSKKQNFNTSGSADTRVVMFCEDVPSKRPTDPGWVSQSSGVPLNVHGKEEQIL
SRSSRPAKAFSCQKIHQTQSTFSGLNCHIIYCSERKFPTSYEEIELLWRQFLKFKETELP
VKEADKNHSKAIYQSFESAVHAGQVKVPPGYHPFDVEKEWGRLHVAILERERLLRIEFER
LERLQRIVSKIQMEGHGCDEKELTVLPLKRIYDDIRLLNAGKPAQHAAEVEREMDKVDNV
IRLFFNDVQILKDGRHPQAEQMYRRVYRLHERFVNLHSDYNLRPKPKVRPELDDVTLRYI
QDLLAWVEENQHRIDEAQWGSDLPSVESQLGSHRGLHQTVEDFKSKIERAKADETQLSPV
SKGTYREYLGKLDLQYGKLLNSSKSRLRNLDSLHTFVSAATKELMWLNDKEEEEVNYDWS
DRNTNMAAKKDNYSGLMRELELREKKINDIQALGDKLVRDGHPGKQTVEAFTAALQTQWS
WILQLCCCIEAHLKENTSYYQFFADVKEAQDKIRKMQENIKKKYSCDRTTTTTRLEDLLQ
DAAEEREQLNEFRTLVNNLNKRAKSVIQLKPRNPTTAIKGKLPVQAVCDFKQQEITVHKG
DECALLNNSQPFKWKVLNRSGHEATVPSVCFIVPPVNKEAVDSVSSLDASEQQMISMWQT
LHIDVKSLLSWQYLMKDITQIRSWNINMLKNMKPEEYRLIMRNLELHYQDYMRDSQNSQL
FGPDDRMQVEEDYTKATQHFDNLLHSMEKGQQDETLCKNYISEVKDLRLRIEDCEAETVT
RIRKPVVKETSESNSRCKCCVLLIQKVQVELEGLKKDLNKVSVKSQEVLASPQPSASTPI
LRSELDLTVQKMDHAYMLSSVYLDKLKTVEMVIRNTQGAEGVLKQYEDCLREVHTVPSDI
RQVETYKTKLKKMRAEAEGEQPIFDSLEEELKKATAVSNKMSRVHSDQDVELDHYRQQLS
NLQDRWKAVFTQIDLRQRDLDQLGRQLGQYRNSYDQLILWIADAKQRQEKIQAVPISDIK
TLKEQLAQEKKLLEEIEDHKDKVDDCQKYAKAYIDTIKDYELQLVAYKAQVEPLVSPLKK
TKLDSASDNIIQEYVTLRTQYSELMTLTSQYIKFITDSQRRLEDDEKAAEKLKEEEQKKI
AKMQAELDKQKQLAEAHAKAIAKAEKEAQELKLRMQEEVSRREIAAIDAEKQKQNIQLEL
HELKKLSEEQIKDKIRLQLETTLTQKSTAESELKQLRDKASEAEKHRKTAQEEAETLRRQ
KQKALEDLENLKKQAEDAEQKVKQAEVEKERQIKVAHQAAQNSAAAELQSKHMSFVEKTS
KLEESLKQEHGAVLQLQEEATNLKRQQEDAEKAREEAEKELEKWRQKANEALRLRLQAEE
EAHQKSLAQKEAEKQKEDAEREDDELYRLKNEVVDAQQQRKQLEDELTKVRSEMDLLNQL
KSKAEIDSMSNTEKSKQLLEAEAAKMRDLAEEASKLRAIAEDAKRQRQIAEEEAARQRAE
AERILKEKLAAISEATRLKTEAEITLKEKEAENERLRRQAEDEAYQRKALEDQANQHKQA
IEEKIILLKKSSEAEMERQRAIVDDTLKQRRIVEEELNFEKASSGKLDLELELNKLKNIA
EETQQSKLKAEDEAEKLRKLALEEEKKRREAEEKQKEDTVVQKKLKDEYEKARKLAKEAA
AAKEQAEREAALLRQQAEEAERQKAAAEEEAANQAKAQEDAERLRKEAEFEAAKRAQAEA
AALKQKQLADAEMVKHKKLAEQTLKQKFQVEQELTKIAEDDLSQQRALADKMLKEKMQAI
QEASKLKAEAEMLQRQKDLAQEQAQKLLEDKQLMQQRLDEETEEYQKSLEAERKRQMEII
AEAEKLKLQVSQLSEAQAKAEEEAKKFKNQADSIASRLQETEMATKEKMTEVHKLELARM
NTSKEAEDLQKQMLLEKEKLIEEEKKRLESQFEEEVKKAKALQDEQERQRQQMEDEKKKL
QATMDAALSKQKEAEKEMQNKQKEMKELEEKRLEQERILAEENQKESLTYSELMERCVTD
PDTGLLLLPITDKAAHCSSIYTEEETKDVFNKTTVSVPFGRFQGKTVTIWEIINSEYFTE
EQKKDLLRQYKTGKITIEKIIKIVITVAEEREKKKEITFDGLRAPVPATELLESQIINKD
LFNKLHKGSTTVKEVSELKPVQKALKGTNCIAGVLIDSSKEKMSFYQAMKKDMMRPGSAL
NMLEAQMTNVRQYLYGTGCVAGVTTDSSSKISIYQAMKRGFIKPEVALTLLEAQAATGFI
VDPGIVGPEIHDKLLSAERAVTGYKDPYSGKIISLFQAMKKDLVPEDYALKMLEAQTATG
GIIDPEFQFHLPADIALQRGYITKETNERLTDSVKGFVDPVTEENVSYAQLLKRCKLDGG
LRLLSLGDKRLMFKGLRKQITMEELIRSQIIDQQTVTELNEAVDFPSTSKGTSCIAGVFL
ESTKERLSIYQAMKKNMIRPGTAFELLEAQAATGYVIDPIKNLKLTVNEAVKMGIVGPEF
KDKLLSAERAVTGYRDPYSGKTISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHR
LPVEVAYKRGFFDEEMNEILTDPSDDTKGFFDPNTEENLTYLGLMERCITDPDTGLVLLL
LKEKKKEKQASSKSSVRKRRIVIVDPETGREMTVYEAYRRGLIDQQTYLELAEQECEWEE
LTVTSSDGTVKSVIIDRRDAMDKSMVELHQCPEMPCFSTDSLLDGFIIFCRLKKLLCLAQ
HLRRKITDIVICKRDVDSLSQWQCDFRDQIRALRQWLKSMEKTDCKYVLEEEKWLDPLLM
VLGSTVIQGKCDSRQVMGWLGHHQSENGGGVEWFLKCNNALKSATNAEENGNPRSNMETP
NQNQLQSNRHSNSDQDSTFQKWKVCSFNELNQFFRINTTEQHKLITVKTNSFTVSFKGKT
SALALRDASTDSGTFLQSLDALLTWVCEIEELKANQKPPSSEVKVVKAQLQEQKLLQRLL
TDRRRSMDTIMLDGAQPVDAGEEPGGQTKLKLSTLKQKWEALQLDAEQRRAALELILPRA
QLFQEGVDSLQQWFMFVEQTLAELRNAERVMLHLPEATDRAKAVVEEIQIKSADLGEIQK
SGHGLMEALSEEEAQQVQEKMDTLRIRCSVLNLSSLDVLQRLEQALEASSRCTSSQEDLH
LWLGRIERELLVAAGAQTHTGDAVLCSAERQRKLYQDLANMLEQAVVKEKTWFEGTAQSL
EKLKIIHLDSEDIAEQLYEQKVRTFLLMINKILPKLCFKYSNEQILAVEILQHRFNIEKM
VKIAEILLTYEEESGTLQTSLEVLQEKCNTTTATNSHVVLQLEHAQSLLLQFSEGLTEVS
PWLEETQFLVGQLSLSTISYEAFREQQDLLQGLRESIAEHRPLVARLCSLAKRLSELNPT
QGKDFCRKAAEAEEQHSAIRDRVRQTAKLLEESLPRLTQLNERMSILRGSLERLHNRLQA
PSSLQGLTPRIQEQLQDNKHSRDELLKMELGLSSIKTHAEELLANTQAAGDGTVGTAIQE
QVSSLTQMWNEANVQAQERECWLLKLLDLSVKFWSDVSDVTVALTDTHQAVVDLNVSQTD
SETIRQSLESMQTLMEDIDSLQGDLDTLGVLGMELMSSCGDTDKPDVTKCLDELYCTWNS
LSKLWSECHKKLEESLQLALNYQDTMQGLFEWLKSAELRTTEEFVIENDLESVKEQLCDL
KEFKRELYQKKIEIESLNHRFVCRLSPGSERPGSVSPLCDFRQRWDSLESETVGRQHQLE
CALLGLGQFQNALDELHTWLSRTAEQLEGSRPISIDLQACEIELAKHKVLRNDVMSHVRT
MESVNQAGKNLLEVGSGDSPNGLQARLEELNDSWEFVRCETERRQLELENRLSQVQDVTI
EIQDLLQWLDSTDLRLSSSKTMWGMPDSASERLNVHLELCNEMDSKLHTYTDVKSAINRM
MESSNVVHGSSTEHSLSMLEQKWTSVYNKVQERKTKLAEGLNLAKEFHSNVQELLLKMCK
CEESIGLLPAPSFVLDTVCSQLQDHRKLVSEVNNYSEMRNTMEDTARRLTELSRKEDCDV
IHNLMMIVLDRHKKLQLRVAERGKILEEVKKNAKQFNESWRLIMDWMMEVDRTLDTHKEI
AVSHEEIKQQLTEQKGFQKLLRSKRPMYTASLKSGRSLHDRAQTSQDRQHLENLLAELKD
TWDTISGKSMERQHKLEEALLFSGRFTDALQALNDWLYRAEPQLAEDVPVSGDKDMVHNL
MDKHKVFQKELGKRAGCIRTLKHSVRDLTRGSTADGHWLQEQMDELEGRWEAVCKLSVSK
QDRLEAALLQAEKFDGLVHSFMDCVTEVERGLKYGVMPEEEEPLHLFRKEHKELMAALQA
QAANLQNIQCLGGEILASCHPDSIITIKSWISVTKTRYEEVQTWGQQQSQKIEASLAALE
AEKEEIQRLLDWISSAEEALCLRDQEPLAETTEQNKELIEQHTVFMEELNKKFPDVEAAT
KSCRHKSTPKQVSPSKRPLTKKRSTQKMQLAVPIPLEHLDPHTPELSQLVSQWQKLWLLA
VARQKYLEQHQQALREGAVQMEEFANFDFNIWRKRYIQWISHLKSRILDVFRSIDRDQDG
RITHKEFVDYVLASKFPTNSLEMNAVANIFDMNNDGFIDYYEFVSALHPSRDPYRKTLDA
DQINEEVSRQVSQCNCPKKFQVEQISANRYRFNHVFCLLQFGDSQQLRMVRILRSTLMVR
VGGGWTALDEFLVKNDPCRVKGRTNLKIKEKYLSPTGSSSKGLTVSRSNSSLSLYSSASA
PT
Download sequence
Identical sequences H3DP08
99883.ENSTNIP00000022257 ENSTNIP00000022257 ENSTNIP00000022257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]