SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022502 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022502
Domain Number 1 Region: 975-1116
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-21
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 2056-2211
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 3 Region: 1836-1960
Classification Level Classification E-value
Superfamily Spectrin repeat 2.57e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 4 Region: 2401-2564
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-17
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 5 Region: 1093-1234
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-16
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 6 Region: 1426-1559
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 1964-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000288
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 8 Region: 768-909
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 9 Region: 2525-2668
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000828
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 10 Region: 1744-1849
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000254
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 11 Region: 1302-1408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000835
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 12 Region: 543-646
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000136
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 13 Region: 1561-1676
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000259
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022502
Domain Number - Region: 692-803
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000314
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number - Region: 382-484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000929
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 9-79
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0563
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 142-246
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 0.0575
Family Transferrin receptor-like dimerisation domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022502   Gene: ENSTNIG00000019300   Transcript: ENSTNIT00000022741
Sequence length 2814
Comment pep:novel chromosome:TETRAODON8:10:11384200:11411144:1 gene:ENSTNIG00000019300 transcript:ENSTNIT00000022741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRVDQAAHDASKEQVVLWQEELRSLQAAVEEQAAQLELVASDASKATISRSMTTVWQRW
TRLRSVARGQERVLEDTAQNVDKLAELQQKETGFFKVNCFANQLMQFLLNSKKSLPMLIM
PKKRSRFEMASLLLLLQNMLLEIEEKVLALSELSIHSENFLLEGQTDMREDAEQLARRLH
TLKGGLLELQKMLQDKQMNIQGSLQQQEESDSDSSLSQSPSVQDWLAQARTTRSQQQEDS
LQRQRELEEQLAEQKKLLQLVASRGEEILIQQASPSVASSVDPFSAASVDERESQAAQEQ
MRQKWESLRLELKTKLQLLQKNLEKEHKLVYSRPSCVTTSGSLFKEESQVDKSSLKTLFD
NFKQTIEDIPSQSQPSDESQLLQMEQQLYVAVSSTSSWLDGVENNVLSGPALLPENPESH
LQKQETLENEMKHVAEDVKLSKALLVGTSGLKLEDQALIEGNLDFLEDRLGALGCVLEKR
CDHIKTRSHELTAYQTELQVLQTSLIETKCQILQALAGAMDRPASKQLEVIGNAEERLKD
FEQKITELKTRGATLQADQISTNKILKLQDSYEELLMTVGCRRSGLNQNMALKEQYERAL
QDLTDLVDTAKDKMAADKRIIASSVEEVQSHLDKHKEFFQGLESHMILTEAYFRKISSLM
LPKERQALEDTLDQAQTVLKQAHGKGVELECILETWCQLVQDYQSLNHQLEAVEGNIPAV
GLVEETEERLMDRITLYQGLKGRLTEHQHKLYQLLDEGKHLLVSVCCPSLENQLALLGEH
WLNNTSKINNELQRLEAILKHWTSRYQRECAELSQWLQSALEQLEFWNTQAILVPQELET
VRDHLSAFLEFSKEVEGKSNLKSAVVTEGNQLLRLKKVDTVVLRSDLARIDTQWTELLTR
IPVVQEKLHQIQMEKLASRHAISELFNWISLMENVTQEDEENLKSAVGSNVIQDYLQKYK
GFRVDLKAVDFVNQSVLQIGGQDVESKRSDKTDFAERLGAMNRRWQILQGRINERIQFLE
GLLEMWFEYERSVQALKSWMANQEDRLKKKHRMEDLSSVQNALKECQEMEDLVREKEKEL
ERVEEQGCALVQNKTDEACAIVMETLQGVNHTWANLDHLIGQLKISLKSVLDQWSLYKQA
SEEINGYLMEGRYSVSRFRLLTGSLEAVQLQVQSLEGLQEELEKQESSLRKFGAVTHQLL
RECHPSVSDSLNNTLKDVNARWTCLLEEIVERLRSSKALLQLWQRYKELFEQNCSNIEFQ
EEMADKLLKLACTKDIADDKLSDWIEECSEVLRAQAPLQASLQVLQELGDQLKQQVDTSA
ASALQSDHISLTHRLAAVEHALTRQLTTLQTGVQDYEIFNEQLDSLGNWIVEAEDALKVQ
DPNGSTEPTVVQDRMEELKKLMLKFSSMAPELRLNELGYRLPLNDTEIKRMQNLNRSWST
ASGQTTERFSKLQSFLLQHQTFLEKCETWMEFSVQTEQNLAVEISGNYQSLMEQQKAHEL
FQAEMFSRQQIVHSIISDGQKMLEQGQVDDRDEFNLKLALLSNQWQGVVRRAQQRRGIID
SLIRQWQRYREMVEKLQRWLVEVAQSAEVLQSGATVPLQQARSMLDAVQLKEKVLHRQQG
SYILTVEAGRQLLLSADSCAEVDLQAELSNIQEQWKHACSHLEEQRKALTTLLKDWERCE
KGIGASLEKLRAFKRHLSLPLPDHQEDLQNEQMRCKELENTFDSWTGDLAHLSVLRESLS
CYISAEDLSVLQERTELLHRQWDEICHQLSFRRQQITEKLNEWAVFNDKYKELCEWLTNM
ESKVSQNGDISIEEMIEKLHKDYQEEIKVAEENKVQLHHLGERLAKASHKSKAVEIEQKL
NKVGDRWQHLLDLIGARVKKLRETLVAVQQLDKNMNSLRSWLAHIENELSKPIFYDSCDF
QEIQRKLDLQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDTECDSIQQATRSLDRR
WRSICALSMERRLKIEETWRLWQKFLDDFAHFEEWLATSEKTAARPNSSGVLYTVAKEEL
KKFETFQRQVHESLTQLELINKQYRRLARENRTDSSCHLREMAHNANQRWDNLQKRVASI
LRRLKHFINQREEFETARDGILVWLTEMDLQLTNIEHFSECDIQAKIKQLRSFQQEISLT
TAKIEHIFHQGETLIEKSEPLDAAVIEEELEELQRYCQEVFGRVERYYKKLIRLPLADDD
TEVSFSDRELELDEPGDLSSIPWNERLGDGFLSPLPSSGRSASLAAQLRTERSGRDTPAS
VDSIPLEWDHDYDLSRGLESAAGALREQQSEEGDFLQRPSSSLSDVVIPESAESFVKLTE
QTLRSCTGEVASADAHIHPLDATRFHLQQLEGSRSRTPTSTETDASYMGYMRLLGECRGS
IDAVKKMGFELKEEEDTVSGLADPSSSESQTSGVIERWELLQAQDLSKEIRTKQNQQQWQ
QLNSDLNNIWTWLGQTEEELEQQRRLELCTDIQTIEQRIKKLKELQKAYDKRKPIVLSIN
LCSNEFVQTDSAESRELQAKLKDMNNHWDRMGSSLEEWRRALQEALMQCQDFHEMSHGLL
LWLENIDRRRNEVVPIDPIQDSDTLHEHHKTLTQIRQELLDSQLKVASLQDMSLQLLVNS
QGSDCLEAKEKVHVIGNRLKLLLKEVTRDLRELAKILDITSSQQDLSSWSSADDLDTSGS
LSPVSGRSTPSRRRSQRGKCSVSQPGPSVCGPHHRCRSGAGSVSFPSDPGAPSDRRGFVR
RVLCVALPLQLFLLLLVVFAFLLPLSEEDYCSQTNNFAHSFYPMLSYTNGPPPV
Download sequence
Identical sequences H3DPQ3
99883.ENSTNIP00000022502 ENSTNIP00000022502 ENSTNIP00000022502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]