SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000093 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000093
Domain Number 1 Region: 621-1032
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.35e-121
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000604
Further Details:      
 
Domain Number 2 Region: 285-618
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.96e-82
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000192
Further Details:      
 
Domain Number 3 Region: 23-284
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.73e-76
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000189
Further Details:      
 
Domain Number 4 Region: 1240-1406
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.06e-48
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000093   Gene: ENSTNIG00000000613   Transcript: ENSTNIT00000000117
Sequence length 1706
Comment pep:novel chromosome:TETRAODON8:1:16615425:16633601:-1 gene:ENSTNIG00000000613 transcript:ENSTNIT00000000117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVTVLALALALVVGSQATAPYFASDNTYVYSYEARILGGLPEEGLARAGLKIRCKVLIR
KANDALFNLSEPEILEYSDIWPKDAFSPATKLTTALATQLSTPIKFEYANGLVGKVYAPA
GVSATVVNIHRGILNVLQINIKKNQNVYDLQEPGSQGVCKTHYIVNEDRKAERVLLIKTR
DLSHCNVYKVVGLAYTHRCPECEATGKSLNGASTFSYVLKPTAQGSLIMMATSEELIQFS
PFNILKGAAQMESRQILKFLNIVKTPLEPVRADYVPRGSLQYEFGSELLQMPIQLLRITN
AEAQIVEILNHLVNFNVAKVHEDAPLKFIELIQVLRVVQFKTIEELWERFKAKPDYRNWI
LHAIPAIGSHTAVRLLKEKFIAGELTIPEAAQALIASVHMVTADIEVIKLFEGLSVHAMI
RENPVLREVVMLGYGTLVAKYCAENPSCPAELVRPIHEIVIQALDKVAAEELILGVKVLG
NAGHPGSLKTLMKLLPSFGASGTRVPHRVHVEAALALRNIAKKEPRMVQNIAVQLFMDKT
LHAELRIAATIVLFETKLPMGLVVSLAKAVLKEENMQVASFVYSYMKAMTKNTTPDYASV
AVACNVAVKLLSPRFNRLSHRYSRALYLDAYYSPWMMGAAASAFYINEAATVLPKTIVAK
ARTYLAGAFADVIEVGVRTEGVQEALLKMNDQNTQRIDKIKQIVQALAGWRASPSSQPLG
SLYVKLFGQEVAFANIDKAVVDQVIEFARGPAISSYGRMAWEALLSGFKMHLVKPMLVAE
IRRIFPTAAGLPMELSFYTAGVAAATVECQGTVTPPLPKDFHASQLLNSEISMRAAIAPS
ASLHTYAVMGINTAFIQAAVLSRAKVYTVLPAKVQAKLNMVKGNFKFDLLPVQAVDKIAS
AYVDTYAVARNVEDISAAKLTPILPDQASLELKKHSSWMTSSSSSSSRSSETHSSSQQVV
DRSEILKGYESKLCKEFETYGIKVCADIETHNAAYIRNSLLYAIIGRHAAWIQLARASGP
SIENIEIEIQVGDKAAEKVLKTINLSEEEEVLEDKTVLMKLQKILIPGLKNSSSSSSSSS
RSSSSSSASKPSSSSSSHHKSKMVDVNSPIFKKSKKSSSSSSRSSVLSRSSSSKVSSSQH
GGHSTSSNSSRSSSMSKREHGFRAVSRSSSSSSASNLASLFSASSSSSHWRSRVTEPSGK
TPRFIKNHRKQTMSAPSSRSSRGSFQAIYEQTKFLGKQAAPTVAVIARAVRGQAVAGYQL
AVYFDKPTARIQVVLADLASENHYKMCVDAVVLSKHKVTAKVGYGVTCEKYTTTITAETG
LVGPSPAARLRVGWNQVPAALRYAWEKAMRSIPISILPSFDLQKNKYVANQVSFTIVAPT
EKTLNIILKTPMYTISKMDVPLPISLPISEIKDLTPFDDIVDKITFMVAKAMAAAECSYT
QDTLTTFNNRKYKPRMPLSCYQVLAQDCTDEMKFTVLIKNDHVEQKHINVKIADIDIDLF
PKSASMGVKVNGREIPVANLPYQHPKVKLQIRQKGEGISVYAPSLGLHEVYIDRNTWRVQ
VVDWMKGQTCGLCGRADGETMQEFRTPSGFLTKNPVTSAHSWILPAESCRGTSATECRIK
LESVELEKQAVVYGQDSKCFSVQPVLRCLPGCFPVKTASVTVGFHCVAAESNLNKSEVLR
GIHEKSVDLREKAEAHLACSCTAQCV
Download sequence
Identical sequences H3BVT1
ENSTNIP00000000093 ENSTNIP00000000093 99883.ENSTNIP00000000093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]