SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000495 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000495
Domain Number 1 Region: 467-607
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000209
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 2 Region: 247-364
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000202
Family Spectrin repeat 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000495
Domain Number - Region: 381-493
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00124
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000495   Gene: ENSTNIG00000005546   Transcript: ENSTNIT00000001713
Sequence length 756
Comment pep:novel chromosome:TETRAODON8:2:9519444:9527689:-1 gene:ENSTNIG00000005546 transcript:ENSTNIT00000001713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATIILPILRKKLAFLSGGKDRRSGLILTIPLSSDQTSMEELSTTLDYLLSIPSEKCKA
RGFTVIVDGRRSQWNTVKTVVLIVAGNVIPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDR
LGFEVILVSANRVTRYIEPSQLTDDFGGSLDYDHGDWLNKRLVFEKFTKESTSLLDELSV
INESDKSTSNKDKSADSVLLPSFDPEAVLQTGHELLSELQQRRFNGSEGQGQAGPAWCPM
EEELLAQPQVIKLLDSLREQYTRYQELCRQRNKRTQLDEIHAKVMQVVTWLQGPGSELLK
TQQEIGDSMRAAQALQQKHEEIESQHSEWFAVYVELNQQIATLLNVGEEEDVAELKALQQ
QLSDVCYRQATQLEGRQNVLQAAQGFHSTSQELSQQLDGLLGMLCADVAPADGASIQQNL
KLLEEKLQSVEAGLASLRQKGALVLELMCNQPSWSLEEAGSPAEEQQNNVQQIQAVMEEM
QLRKQRCEDMVDVRRLKMLQMVQLFKCEEDSLQAVQWLGELLDALLKTHIRLGDDAQETR
NMLDKHRKFVEVAQSTYDYGRQLLQATVVLCQSLRCTTRSSGDTLPRLNRVWKQFTVSSE
ERQQRLELALEFHTAAEHVFEQECADVEALDDVDSSGKTLLDRLTMPVIFPDGSEQFFGS
PTEAAAAAEGIRERLLLVEERRLQLQEMGLRHEEEVPNRQDAWLDMIGEDLREKEEQDYV
EEEEEEEEVEEEGEEEVEEEGEGQEDEDLTRTSKDC
Download sequence
Identical sequences H3BWY2
99883.ENSTNIP00000000495 ENSTNIP00000000495 ENSTNIP00000000495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]