SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000505 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000505
Domain Number 1 Region: 1340-1478
Classification Level Classification E-value
Superfamily PRC-barrel domain 7.61e-60
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000137
Further Details:      
 
Domain Number 2 Region: 216-307
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000193
Family Calponin-homology domain, CH-domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000505   Gene: ENSTNIG00000015295   Transcript: ENSTNIT00000002523
Sequence length 1482
Comment pep:novel chromosome:TETRAODON8:15:5090939:5107618:-1 gene:ENSTNIG00000015295 transcript:ENSTNIT00000002523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHYDFTRAKVSCSLTWLVAKAFGSDAVPEELAEPLYRDQYNQEHLKPTVASLLQSAELYC
RAGSLILRSDAVKPLLGHNAVIQALAQKGLYVTDQDRLVTERDLTSMPIHMSSHLALIDT
LMMAYTVELMSVERVMSCISRYTSAEPSRSEDHFQELPYDTEDAIVTWINKVNLRVKIII
HHQVSYHLPLTSLWQHLKARYRKEHGQQRSAPSLPLVENLLKDNTDGCALTTLLHFYCST
VIRLDDICLKETMSLADSLYNLQLVQEFCKNNLNHCCHFTLEDMLYAHASIKSNYLVFMA
ELFWWFEVVKPSFVQPRILDTNGTGQLFRQISTCNQVSSGKKMAPVSSPVKQKQTERPGS
PGSVCAEGYLFITITITNCLPPFPSTNRTSLNVSIRAAGVMKRSTSLSFVDGCIGTWPKE
KRSTARGISFEIPLDGERMVPSCEAPSLSSMTRSASSDSLGFKVHFASWGGVRRHPSAIH
VNVNGRSSHILEEDEDFTSHKHPERNNTITVKNHNRYSSICVCVSALFSNQENIAAIRCP
NGILSDITHSGNNHHGNHSGHISPSTPPSIEEALKIIHDTERPHASLDMGGGEGFFLHGA
EPLEPPGAHGEGDDAGSAKTHLNDHEPNSVSTDEVDTGIHVRTEDIQSLDEDSSSLRDYS
DMDPDCEAMTRSCPNYERPDRERNRDEGQRGVGGADPEGGRGSGGDRSSPCPSSAPTLPR
SHTMSPASSSASSGSGLVRMTSFAEQKFRKLEGRSSGGTTPISTPPLPITSPSPVTTFPR
DPSHLLASEMIQLRMKLEEKRRAIEAQKKKVEAAFTRHRQKMGRTAFLNVVRRKGINAPI
SPRHLPHSLSHPQWKPAKVVWSGQKDANRTERLLNPPARTEEVRIKRALNKPDQIGYHPT
DPRVSCGDSGVTPGEADLADYTRSIERLNTSLGFLQTEMQRLAQQQEKIMAMAWVIPAPA
PSPHSNSNHMKRGSPHAPNRSPAGIKRRPASFHARTPRTPRPNDLKVTPFSRMLNPPTSV
DSLPRLRRFTSSQKRPAEKRDGNEETAAEERAGTGQLKQENKGKHEDEQSQAERARSMGE
DKHRRSAEVLQQPLPENKRPISSRVKAENQDRRDLVEVPLSGLKPPEGPSSGQEMEGEED
GDDQKMCCGFFFKDDVKGEEDMAAKKAALRSTVVLRSTLSGLKESWFVPKLNLSLCSRLK
AEEEQQKKEEEKARREYIRNEYLRKKQLKLMEDMEEVIKPRSGSLKKKPRPKSIHRDVAD
SPTPLCSHCPVGVRPRGYSVSSVSLASLNLADNDKDLPNNRKNNRPDSAGGFSSCPSTGS
RNGEKDWENDSTTSSTPSNTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKNK
ILDEMEKSEANNFLVLFRDAGCQFRSVYTYCPETEEITRLAGIGPKSIKIKMIEGLYKYN
SDRKQFSQIPAKTMSASVDAITIASHLWQTKKQWTPKKLHSK
Download sequence
Identical sequences H3BWZ2
ENSTNIP00000000505 99883.ENSTNIP00000000505 ENSTNIP00000000505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]