SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003720 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003720
Domain Number 1 Region: 1284-1417
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.41e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000103
Further Details:      
 
Domain Number 2 Region: 234-328
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000565
Family Calponin-homology domain, CH-domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003720   Gene: ENSTNIG00000018556   Transcript: ENSTNIT00000002167
Sequence length 1427
Comment pep:novel chromosome:TETRAODON8:3:11740315:11756393:1 gene:ENSTNIG00000018556 transcript:ENSTNIT00000002167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSPTMKKSFVVSDIKPLDLYDCTKAKICASVGWLFVKSYGCTENVPAELRDPFYCDQY
EQEHLKPPVTRLLQSSELYCRTYSLLLERPETGERPKDNAALVQLLGKRGLLSKDQDTAV
TEADLQQKPIKMGSHLAVIDALMAVAAMETLAAARTGTSAYLQGAGCNWEDTMLHWVNVI
NQKLRESNKEAQTDASQAITESELVQPSCPTRWYWKLFPLRYRKDKMQSRHKPVFPVVNE
VKDLSSGCAIAAVIHYYCPGLLRLEEDICMKESMPVADSLYNLQFIREFCDSCLKSCCHL
ALEDMLYIPQELKINLLSFLAELLFWFEVKRPEFVQPIDTSVITSPSTFKKPFLPIASNA
PVHIENFLGVFWGAALLICASVLHAFICLCVCVPLLYSGSLTQSTSMSHIEGAGQTWSKK
SLSRPLSGISFSIPFGLDSDVDIVMGDPVITRSVSSDHLIPSGQNTNHMPPEDLGHLQIK
APVSSPQRASWTAQSHGIPRVAEENGVAASETGELPTIEEALQIIHNESKLEPRLHPDGA
PDGFYLHSPDDPASSRNNSAKLANISSSAPTHSGMIYRPTSESREPTRTRNTSECSRDDD
SVLRDGSVDSDASEDMPKAQSTPASGTHSARGDSGVRMTSFAERKKKQMDSPKASDSTSP
EMTTWAHKSEESPSNSPQLNDMSELGVRLEEKRRAIEAQKKRIEAIFAKHRQRVGKSAFR
QLKKEQLEDEGGEEEGGDVLVSISSTEEDLSRLSLDENQAQIAEEKQREEREQRLSVEDG
GNVKEEREPNKQVGNFNEKVSGTAGQKTAPLGDYNNAVSKLTAALSSLQSDMQRLTEQQN
HLLKKKPAASTSKSWVIPASPRTSTPASTPVRTSREPTRNLNSASTSPSPSHKLTTPTTP
KSPQVQRRARSVPPKSPKHHQQSRPLDVRPPTYSRVITAPQNVDRIPHLRRINPWQSQVQ
TSSSFTIGDSDTLDELRASRLTPASTPIQTPVPPATPTPHPAADETLSEIGSNDGHSVFT
MDLDAGDSHGVSSKKSDVPAGPLNGKRSSLIEISLSALRGDGEEDDQVPDPFSDAMSDRT
DPDMKGGVGFFFRDDKARPEDEMAQRRAAFLEKQQKRAEEMKRRKLEQEKEKESKNEERP
RTPGTPPASGTPSVDGTPQRRGDFTRQEYERRQQLKIMEDLDKVLRQKPTTVRGVKKQRP
KTVFRDDSSLSQSPVKGLIVSQVIVITCFFFLNAADVLIIHLESMLTPSRSHSPSRFMSP
RRMSGQNGEKDWENGSTISSPASVPEYTGPKLYKEPSFKSNKFIIHNAITRCCLAGKVNE
PQKNKIVEEMEKSAANHFLILFRDASCQFRAVYTMNPETEEMVRLTGIGPRIILPEMVES
IYKYSSDRKQFTVIPSKTMSMSVDAFTIPGHFWQKRPGTPKKLGTPK
Download sequence
Identical sequences H3DMI2
ENSTNIP00000021730 ENSTNIP00000003720 99883.ENSTNIP00000021730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]