SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003818 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003818
Domain Number 1 Region: 11-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-111
Family Capz alpha-1 subunit 0.00000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003818   Gene: ENSTNIG00000016059   Transcript: ENSTNIT00000003998
Sequence length 286
Comment pep:novel chromosome:TETRAODON8:13:11129053:11131996:1 gene:ENSTNIG00000016059 transcript:ENSTNIT00000003998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTGSEERKSDSVQVRIAANFVIHAPPGEFNEVFNDVRFLLNNDNLLREGAANAFAQYNLD
QFTPVKIEGYEEQVLITEHGDLGNGRVLDPKNKISFKFDHLRKEASDPRPHDVDSSIESW
RSAVDSAVRVYVKDHYPNGVCTIYGKTIDGHQTIIVCIECHQFQPKNFWNGRWRSEWKFT
ISSSSTEVAGIMKIQVHYYEDGNVQLVSHKEVQESMSVSGEASTAKAFVKIMEAAEKDYQ
TAINENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences H3DF55
ENSTNIP00000019149 99883.ENSTNIP00000019149 ENSTNIP00000003818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]