SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004414 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004414
Domain Number 1 Region: 147-268
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-32
Family Spectrin repeat 0.00000316
Further Details:      
 
Domain Number 2 Region: 49-135
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-20
Family Spectrin repeat 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004414   Gene: ENSTNIG00000002006   Transcript: ENSTNIT00000004554
Sequence length 379
Comment pep:novel chromosome:TETRAODON8:Un_random:46813437:46815294:-1 gene:ENSTNIG00000002006 transcript:ENSTNIT00000004554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQQGLGQPGGSGEGLRGVAPQRDPPAGEARPPGGEVPSEGSHPRSLDRSKEDLLQNRDYE
TASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQW
DALGALTQKRNEALQARPWRNEPTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTF
IVHTIEEIQGLSTAHEQFKSTLPDADKERQAILGIHNEIAKIVQTYHVNMAGSNPYTTIN
PQEINTKWDKVRQLVPQRDQALIEEHARQQNNDVCAASSPTRLTSSGPGSKPRWRKSAAS
PSRCTARWRISCTTCASTRRASSTTSPRSTSWRETTSSSRKPSSSTTNTPTTPWSTSAWA
GSSSSPPSLAPSTRSRTRS
Download sequence
Identical sequences H3C842
ENSTNIP00000004414 99883.ENSTNIP00000004414 ENSTNIP00000004414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]