SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006101 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006101
Domain Number 1 Region: 1303-1420
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.49e-45
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000496
Further Details:      
 
Domain Number 2 Region: 225-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000417
Family Calponin-homology domain, CH-domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006101   Gene: ENSTNIG00000003513   Transcript: ENSTNIT00000006249
Sequence length 1420
Comment pep:novel chromosome:TETRAODON8:18:10011348:10020410:-1 gene:ENSTNIG00000003513 transcript:ENSTNIT00000006249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIKPLHQYDFSRAKICASVRWLLSKWFGSAEDVPLEMREPLYRDQYEQEHLKPSISKLLV
SPEIYCRAHALLLQVQGVSAPPSQGSPGDAEALLQLLEKKGLTPKVQGAEVTLEDLSCVP
IRTNAHLAMMDALMTLAARQTVGRVKMAAQAEQTGTGAPWENALLFWVNRLNQKLRELTE
EEEEEPASRPQTCSDVQPAQDAIRYRKDRVQSKLTPTFPLVYGVKDLSNGCAIASVLHYY
CPGLLPLEDVCLKDTMSVADSVYNLQLIREFCQSSLQGCCPLAVEDLLYAPPPLHLNIMS
FVSELLQWFEMKKPDFVQPVSAIDLTGLWPRRPRRPRRPRRPRPVWLLCPCRVVTSFSPC
LRCLRVTGLYQPHQREWQQSSSGSPSFILKQPLVPITSPVSPVLRGSDRFFCRLSQKIKA
GQRSRSDAHPPLCSRPLSAVTFSIPFGLDSDVDIVMGNPIDSVFRSASTDTGIPAMTASV
SSGGVAHGPYSPPEDISHLVGSSAPLQRSSWGPLRPRGPSGRAAHHRGGSAGCPGAQQQR
PQEKGRQREKRGMPEARLRPEGAPAGFFLHSPEEDQPQLSSSAPCRSGILHRPVGGEGVD
GKEKRERRERSGGTSDMSRDDDSVLRDGSVDSSEASDDGARNAPGNMRPSKGHHGNRGAG
TSPRMTSFAERRDNRRRHPAASGEEAASAPTPTTPGTPHTPSTPAGAPGRQDSPGPRGPE
PGSEAWELGVRLEEKRKSIEAQKRRIEAIFAKHRQRLGKTAFLQLKRQQGEGGGGGAEDN
LTLEERLTRMEEQLTPSASNPPRLEKQVTFSVESKKEAESKRAPEKEKGGEGVLVEYNEV
VQKLSEALQSLQKDMQKLTEQQQQLMSKAWTIPPGSHPNPASPKTAVSSSCPAPRTKIPS
TAPRSPKHHPRPQHQPHPRPSELKFPPLNRMLTPTHNVDTLPHLRRVSPSKWPEGPRAAG
GSSSGAPSECSFESETFSISAAYGRGGEARREASGGKHPNEVSLSSLGAPEEAGDEQTDE
GQEFSSDSMSDHTESAVEPARRPAAETLDPTERLDLAMEAISLPEQPAEPKEEPGAQTVA
TGRSAQQNESATRGGIHFFFSEDERNEEEMAQRKALLLEKQQKRAEELRRRKQWHEQERE
NRLASSERRADSPSATPPAGTTSPSPTPPATPARRGDFTRSEYARRQQLRIMEDLDKVLQ
QKSTGQVRTPAKKARSRPRSMTREETQLSPARTGAAGSKLVKVHSHSSVNLAAADEPSKK
TNSPVFSFSSRPNSPACVTPSKLANPSADKDWETGSNGTSPAPEYTGPKLFKEPSFKSNK
FIIHNALSRCCLAGKVNETQKNKIVEQTQEMEKSDANHFLILFRDSSCQFRGVYTANADS
QDLVRLAGVGPRTISSIQVESMFKYSSDRKQFSSIPSKTL
Download sequence
Identical sequences H3CCX8
ENSTNIP00000006101 ENSTNIP00000006101 99883.ENSTNIP00000006101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]