SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009144 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009144
Domain Number 1 Region: 112-239
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-41
Family Calponin-homology domain, CH-domain 0.000000589
Further Details:      
 
Domain Number 2 Region: 4-82
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000628
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009144   Gene: ENSTNIG00000006379   Transcript: ENSTNIT00000009315
Sequence length 240
Comment pep:novel chromosome:TETRAODON8:Un_random:86262080:86263298:-1 gene:ENSTNIG00000006379 transcript:ENSTNIT00000009315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTPMSPEEEEELREAFAKIDVDNNGFISKDELNQLFQAANLGLPGYRVREIIQELMI
SGDQLTFEQFTQMVGSLRSSEVAKTFRKAINKKEGICNVAGRSEQSGTQHSYSEEEKVAF
VNWINKALEKDGDCKHVLPMDPSSNDLFTAVGDGIVLCKMINLSVADTIDERTINKKKLT
PFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSKNE
Download sequence
Identical sequences H3CLL5
99883.ENSTNIP00000009144 ENSTNIP00000009144 ENSTNIP00000009144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]