SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009638 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009638
Domain Number 1 Region: 29-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-86
Family Calponin-homology domain, CH-domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-33
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 514-635
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-30
Family Spectrin repeat 0.00000244
Further Details:      
 
Domain Number 4 Region: 743-870
Classification Level Classification E-value
Superfamily EF-hand 6.84e-24
Family EF-hand modules in multidomain proteins 0.015
Further Details:      
 
Domain Number 5 Region: 400-509
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-23
Family Spectrin repeat 0.00000281
Further Details:      
 
Domain Number 6 Region: 639-750
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009638   Gene: ENSTNIG00000006845   Transcript: ENSTNIT00000009813
Sequence length 898
Comment pep:novel chromosome:TETRAODON8:Un_random:1431755:1445919:1 gene:ENSTNIG00000006845 transcript:ENSTNIT00000009813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVETQITYSNSYTIHQDEAYMIQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNEALDFICSKGVKLVSI
GAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFH
ISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPKMLDAEDIVNT
PKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWI
RRTIPWLENRVSEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERVDHLAEKFKQKCAMHEAWT
AAGKENLLSQKDYETASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDA
ASVNSRCQGICDQWDNLGTLTQKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAM
EDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATLGIHNEILKIAQTYGIKLSGI
NPYTTITSQDITTKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTK
MEEISHVSVDISGSLEDQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYS
MEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPD
DFRACLISMGYDLGEVEFARIMTLVDANNTGVVTFQAFIDFMTRETAETDTAEQVMASFR
ILASDKNYITVEELRRELPPEQAEYCISRMTRYIGADSPPGALDYISFSSALYGESDL
Download sequence
Identical sequences H3CN07
99883.ENSTNIP00000009638 ENSTNIP00000009638 ENSTNIP00000009638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]