SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012893 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012893
Domain Number 1 Region: 21-127
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-25
Family Calponin-homology domain, CH-domain 0.00089
Further Details:      
 
Domain Number 2 Region: 588-666
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-19
Family DIX domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012893
Domain Number - Region: 432-548
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00795
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012893   Gene: ENSTNIG00000009998   Transcript: ENSTNIT00000013085
Sequence length 671
Comment pep:novel chromosome:TETRAODON8:7:4504973:4510667:1 gene:ENSTNIG00000009998 transcript:ENSTNIT00000013085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASLSRGNLLDEVLHGGLGEQQLVAYVSWVNSQLKRKPGLKAVRDLRHDLQDGVVLVQL
IEIVAGEVLQGVYAAPQNKEESRKNVEQVLRFISSRRIRMPHISARDIVDGNLKSVMRII
LALAAHFKPSANHRAASGKARSLSRGAGSHEPLSPVALAQGAAAALASARHDASQPARST
GYPSWGLDAEKSVCVRALVQQYEKRSPDEQAHVHSGRVEGGVYQGSQTGGKPVNLPSVSL
ESQRCQSAVVSTNAGQQTGGPPASGETALEDALCQTLEKEVEDTRKMVSALQALLLHGSL
PEEEQDVALCLDQGEADQQATVLRSRLDQSMEEARELKRELLRCKQEMRNLQGIKDAQQQ
RLCTQEASILQMKQDLLRASMTKDDLVNKNAELQWKMEEYNRLWGDCKKEIEQKERLLQQ
LKYKLEEKQIAQVEWPGPAQSLSIRLINKRVLVWGWVFCQGTENNGYSHSGSPPSSLSDF
IFTVESAGVTGAESVRGTEEVQLLRDGLRSLRNNFRDHDPQQHTLDTLEQGIVSLIERLH
VLHARRVPNRLGRGKSPRRKTQHADSNNWPSTSKLISNILPPSGSPASTKILYFTGKSPT
PSMISIHKRLGEVTLKDVKAAVDREGNYRYHFKALDPEFGTVKEEVFLDGAIIPGWEGKI
VAWLEEDRGDD
Download sequence
Identical sequences H3CXA8
99883.ENSTNIP00000012893 ENSTNIP00000012893 ENSTNIP00000012893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]