SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012976 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012976
Domain Number 1 Region: 1265-1403
Classification Level Classification E-value
Superfamily PRC-barrel domain 5.65e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000128
Further Details:      
 
Domain Number 2 Region: 242-334
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000916
Family Calponin-homology domain, CH-domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012976   Gene: ENSTNIG00000010080   Transcript: ENSTNIT00000013168
Sequence length 1409
Comment pep:novel chromosome:TETRAODON8:1:18778990:18800107:1 gene:ENSTNIG00000010080 transcript:ENSTNIT00000013168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVQDVRDVRKTFVAPSTKSFEHYDFSRAKISCSLTWLVAKAYGTDCIPADLKEPFYTD
QYEQEHLKPPVASLLLSADLYCRAGSLILKSDAAKPLLGHDAVIQALAQRGLYVTDQERL
VTERDLRKRPLQMSAHLAMIDTLMMAYTVETVSVEKVMACIHQYSSGNTEEETPYDTEDA
VTTWINRVNEYLKEIVTQEQKREAQSAEPAGSPRSPTKWYMKLVPARYRKEQASAQPVPW
IPPVDNLLKDSSDGSALAALLHFYCPQLLQLSDVCLKETMTLADRLYNLQLIQEFCKDNL
NDCCHFTLEDMLYASSTIKNNYLVFMAELFWWFEVVKPSFVKPRLLSNESAEPSSLLKNI
PVIPISKATKRSFMERPPSPERPRYNVCISYKYIQYKILPLRPQPRNSVYLGEIKRSTSM
SFVEGNLGTWPKEKRSGPYGVSFDIPFDKDSSTSVPLSSTRGMIRSVSTDDGSGFKVQHL
PRGMKRNLSFQPVNGTKVVGIVEEGCPDSLAGVEPKSVYPNGHGSFTVTTPSMEEALQII
HNPTRPVAEGIQNGFFLHSQDQGASGLEPVSESDSKGPLSTTDTTEVDTGIHIRTEDMLD
EDSSLKDCSVNMDLDLDSPSPCANSLSKSPSGLKMTNFAEQKLKKHTPDSGRCSSSSLKT
TPEGSDFGVPLSVSWAPTPEHSPVRQQAAPSQGHLPPNDPAQAMATEMVQLRMRLEEKRK
AIEAQKKKVEAAFTRHRQKMGHSVFLSVVKRKGDGASSGEEGGKSEGEGKAASPILKFGR
SKADTPDGAEQSSTGCWSKSPGVGEESLTELDLTEYTRSIEKLNHSLAFLQAEMQRLSQQ
QDVIMAMREQQHQQAWVIPAPHTNPSPQRHGRAGAVTRSSGPSSPADSPLPSHRSPTSIK
RKSASFHSRNPRTARPSELKLAPYNRVLTAPQSVDSIPRLRRFSPSQPLACALVYMEEKP
APNLAPEATDRDKNNDSLDREGRTQDADGQPEITNTSASDLQPTVESSFPEVLSHPVTET
FTVAPTEIPPQPEASGQAKSSLIEVPLSVVKPLEDLTLEDGLEMQQDTPEGSDCDQKMCR
GFFFKEDGKAEENMAQKRAALLEKRMRREKESLQKKLQLEAELEQKKEEARLKAEEERIR
KEEDKARREFIKQEYLRRKQLKLMEDMDTVIKPRASGGGKQRRGRPKSIHRDSLDSPKTP
VRAATVCSLSLASLNLGDSDSVHSEKRSPRPDSADGFLSPSRSSSRNGEKDWENASTTSS
VTSNTEYTGPRLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKNKILEQMEKSEANNFLV
LFRDAGCQFRSIYTYCPETEEINRLAGIGPKSITRRMIDGLYKYNSDKKQFSQIPAKTMS
ASVDAVTIHNHLWQTKKPATPKKVVPVQT
Download sequence
Identical sequences H3CXJ1
ENSTNIP00000012976 ENSTNIP00000012976 99883.ENSTNIP00000012976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]