SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014143 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014143
Domain Number 1 Region: 37-259
Classification Level Classification E-value
Superfamily L domain-like 3.68e-39
Family Ngr ectodomain-like 0.031
Further Details:      
 
Domain Number 2 Region: 535-636
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.46e-22
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014143   Gene: ENSTNIG00000011208   Transcript: ENSTNIT00000014339
Sequence length 675
Comment pep:novel chromosome:TETRAODON8:Un_random:92345094:92352141:-1 gene:ENSTNIG00000011208 transcript:ENSTNIT00000014339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGSRTGSLLVGSNNGLGSVGPAPWNRSVDRALDEATATGCLNLSGRKLKEFPRSAANHD
LTDTTRADLSRNRLPELPLEVCLFVSLESLNLYQNCLRSLPDSLVNLQALTYLNLSRNQL
SVLPAVICGLPLKVLIACNNKLVSLPEELGQLRHLTELDVSCNEIQSLPPQVGQLEALRD
LNVRRNHLLRLPGSELAELPLVRLDFSCNRVTSIPVCYRQLSQLQTIVLDNNPLQSPPAQ
QICIKGKIHIFKYLNLEASKTTPELSDYDRRPLTFSSCGDELYPGRLYGTLDSGFNSVDS
GDKRWSGNEPSEELPELSQRVAEISRDQRSRGAAALLANGTPDVELEQIDFIDSCVRGGG
DTSSLSSQFMAYIERRITREVSAPPTGQLPEPGGLEKMRREAQLAALRYDEERQKSRCPQ
RDTNKPVAAASAASNQTSPPVADTCDPQARLLPVLTGEDRAALSPTASPSANQSPTYPCS
GGGASSRSGSLRPESFLFRLSQKEEKRKGDAAPQSQVDNPAAAPLAGEQAELVEQLRKQN
IEARLKVSLPTDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRNVENF
LEACRRIGVPQDRLCSVREVLEGHGGGLYATVAMLLSMAPPLLSPSPQVQLAGFALFYLS
VMSVLCAIYVHLAPC
Download sequence
Identical sequences H3D0V7
99883.ENSTNIP00000014143 ENSTNIP00000014143 ENSTNIP00000014143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]