SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018666 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018666
Domain Number 1 Region: 1386-1524
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000212
Further Details:      
 
Domain Number 2 Region: 236-341
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000301
Family Calponin-homology domain, CH-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018666   Gene: ENSTNIG00000015593   Transcript: ENSTNIT00000018893
Sequence length 1527
Comment pep:novel chromosome:TETRAODON8:12:4906604:4917252:-1 gene:ENSTNIG00000015593 transcript:ENSTNIT00000018893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMDVDLSAGGNGSRRRVDFPAVAEATVDIIPLELYDSARAKIAANLRWLFAKAYGIENIP
ADLRDPFYTDQYDQEHIKPPAIHLLLSSELYCRVCSLILKTEQAASLQSHMSVIHSLSRK
GIYVVESDDTPVADEDLSCMPIKMSSHMSMIDALMMAYTVEMISIEKVVASVKRFSTFRA
SKELPFDLEDAMVFWINKVNMKMREITEREHKVKHHPLESPSHQKVRYRRDHASGRQLPY
FRVLEELMRDICDGAALLTVVHCYCPDLMKLEDICLKEVPSIADSLYNIQLLREFANQYL
NKSFYLTIEDMLYSPLVLKHNVMVFIAELFWWFETVKPEFVQPRDLQEFKDSRVASQPKS
SRPAVPISNATKRTSLTSPDNQNSPEVCNRYFLHPEDSEPLRAGPSFSPSHPLLPLRQRQ
QKQQEDGNGLRNRSNSLSGTDGQSRGSAVVWPDKRQRPLSTLSPFMFQSATDSDVDRASG
DSVSLARSISKDSLASNVLNATPKHLPAAHQPPPAATCRVNGLHSEGEEGTLAAPRSDGS
LMPKWTDRAQPAAAAAAKLPAEPRPAADTFYLEPLMPATLKTAKEKSVCLNKEEESGEGP
CSSGRGSLQRGDGSVSVVRRKPPCRTSQTSPPDEEKDLSEFRPVVTSCVDPSSKGSARVV
CPQSDSEEPKSRQALDAELEDLDEEEDDLDEAVTTKESSWSRKAFEEDEEEESAKLQEDM
NVKEHEDKDLNGGSGRSSPCLSTHSQASSIASGSVRMTSFAERKAQQQRFGSNHDLYSSA
SSSQRTTPDGSESSGPLSSWRIKRDQSPSSPLGGWSRTGDGSGSANVLASELVQLHMQLE
EKRRAIEHQKKKRDLLMAKQRQKLGKAAFLNIVKKDGGRSDAFPNPLKADIPKEELGGEK
GPSSKESMCAGTENGDKELEGTTLPGALEADEKENSGNICTEEELDPYECSRSIEQLNEA
INSIQQQMMQVSLKQELLIKQNVQSPPGASPTPPSTAEKNGDSKAGASFHYVDHFSGTST
VPTRKPPKLSSSRGSRSKPSELKLGKEQSRLASKALNPPQSGSKTLPQQRHLEGGRSPKR
ESPRTPAKEETVERPGEAHTTFRLHDEANIRLPTRVDPTAVAVQEVSFQECLSSTMKESE
LNSSDGSGKENLPSELSRSKAHLIEVDLSELKAPEEDEAAEDAHSEGGEGEQKSVLGFFF
KDDRKPEGDLAKKKAAFLLKQQKKAEEARLRRQQLEAESELKRDEARRKAEEDRLRKEEE
KMRRELIKQEYQQRKQQEMFEEQNIFKPKTPKPKQRPRPKSVLREETSIESFSKDPSTSD
NLSNAQSGSSLSLASAATNEADSIHSGGAGSQRCDSVESFTGSVNSRATERDWDNGSTAS
STTARTEYTGLKLFKEPSAKSNKPIIHNAISHCCLAGKVNEPQKKQILEELEKCESNHLM
ILFRDSGCQFRALYSYFPDTEEIIKLTGTGPKSISKKMIDKLYKYNSDRKQFTVIPAKTV
SVSVDAVTIHNHLWQAKKASVPKKNGK
Download sequence
Identical sequences H3DDS3
ENSTNIP00000018666 99883.ENSTNIP00000018666 ENSTNIP00000018666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]