SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020148 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020148
Domain Number 1 Region: 26-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-86
Family Calponin-homology domain, CH-domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 278-400
Classification Level Classification E-value
Superfamily Spectrin repeat 8.87e-35
Family Spectrin repeat 0.000000451
Further Details:      
 
Domain Number 3 Region: 514-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-28
Family Spectrin repeat 0.00000258
Further Details:      
 
Domain Number 4 Region: 401-509
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-25
Family Spectrin repeat 0.00000247
Further Details:      
 
Domain Number 5 Region: 639-750
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-21
Family Spectrin repeat 0.00000187
Further Details:      
 
Domain Number 6 Region: 743-870
Classification Level Classification E-value
Superfamily EF-hand 1.94e-19
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020148   Gene: ENSTNIG00000017022   Transcript: ENSTNIT00000020379
Sequence length 898
Comment pep:novel chromosome:TETRAODON8:17:11726821:11737868:1 gene:ENSTNIG00000017022 transcript:ENSTNIT00000020379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTMMMMENAVRYDNGYEDEYMMQEEEWDRDMLLDPAWEQQQRKTFTAWCNSHLRKAGTQ
IENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALEFISSKGVKLVSIG
AEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHV
SQSWKDGLAFCALIHRHRPDLLDYSKLNKDDPLGNLNLAFDIAEKHLDIPKMLDAEDIIN
TPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLGVNQENEKMMEEYERLASELLEW
IRRTTPWLENRTPEKTMAEMQRKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRISN
RPAFMPSEGKMVSDIASAWQGLEQAEKGYEEWLLTEIRRLERLDHLAEKFRQKATNHENW
ASGKEPFLAQKDYETATLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDV
AAVNQRCQSICDLWDKLGTLTQKRREALERTEKLLETIDQLFLEFAKRCAPFNNWMEGAM
EDLQDMFIVHTVEEVQSLIAAHEQFKATLPEADSERQAILGIHNEVQKISQSYGIKAKIV
NPYSIITVEELLNKWEKVKKLVPQRDGALQEEMARQHAHERLRRQFAAQANLIGPWIQAR
MEEIGRCSFEIGGTLEDQMTQLKQFEHVIVAYKPNIDKLEGDHQLIQESLVFDNKHTNYT
MEHIRVGWELLLTTIARTINEIETQILTRDAKGISQQQMNEFRSSFNHFDRKKTGDMDTD
DFRACLISMGYDMGEVEFARIMMLVDPNATGIVSFQSFIDFMTRETADTDTAEQVVASFR
ILAADKPYILVEELRRELPPEQAEYCIMRMPAYSGPGALPGALDYTAFSTALYGESDL
Download sequence
Identical sequences H3DI04
99883.ENSTNIP00000020148 ENSTNIP00000020148 ENSTNIP00000020148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]