SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020149 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020149
Domain Number 1 Region: 24-255
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.02e-87
Family Calponin-homology domain, CH-domain 0.0000139
Further Details:      
 
Domain Number 2 Region: 273-395
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-33
Family Spectrin repeat 0.00000105
Further Details:      
 
Domain Number 3 Region: 509-628
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-28
Family Spectrin repeat 0.00000538
Further Details:      
 
Domain Number 4 Region: 396-503
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-24
Family Spectrin repeat 0.00000606
Further Details:      
 
Domain Number 5 Region: 744-889
Classification Level Classification E-value
Superfamily EF-hand 3.27e-21
Family EF-hand modules in multidomain proteins 0.041
Further Details:      
 
Domain Number 6 Region: 633-745
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-20
Family Spectrin repeat 0.00000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020149   Gene: ENSTNIG00000014277   Transcript: ENSTNIT00000020380
Sequence length 898
Comment pep:novel chromosome:TETRAODON8:16:6725152:6751287:1 gene:ENSTNIG00000014277 transcript:ENSTNIT00000020380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDYHAANNQAAAGPQTYMEQEDIWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIEN
IEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFITSKGVKLVSIGAEE
IVDGNIKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWK
DGLAFNALIHRHRPDLIDYDSLRKDDPVTNLNNAFEVAEKHLDIPKMLDAEDIVGTLRPD
EKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEQMMEDYEKLASDLLEWIRRTI
PWLQNRTQEKTVSHMQAKQEDFRDYRCVHKPPKVQEKCQLEISFNTLQTKLRLSNRPAFM
PSEGRMVSDINGAWHILEGAEKGYEEWILSEIRRLERLEHLAEKFHQKAAIHEAWTDGKE
AMLNQKEPDTTTLSDIKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYESASVNA
RCQKICEQWDVLGTLTQSRKDSLMNKEKQLESIDELYLEYAKRAAPFNNWMDGAMEDLQD
MFIVHNIEEIQGLITAHEQFKATLGEADKEREAIQDIQAEVSKIAQSNNIKLSGSNPYTT
ITSANIDEKWKKVLELVPRRDTALQDELNKQNSNDKLRASFASQANKVGAHIKAKMEEIG
RISIEMNGTLEDQLTNLKEYQESIVSYTPEINTLEGYHQLIQEALVFDNKYTPYTMEHLR
VSWEQLLTTIARTINEVENQILTRDAKGISQEQLYEYRSSFNHFDKDHSGALMAEEFKAC
LISLGYDVENDKQGDAEFARIMGIVDPNGTGAVTFQAFIDFMSRETTDTDTADQVIASFK
ILAGDKNFITAEELRRELPPDQAEYCIARMAPYTGPDASPGALDYMSFSTALYGESDL
Download sequence
Identical sequences H3D9V0
ENSTNIP00000017291 99883.ENSTNIP00000017291 ENSTNIP00000020149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]