SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021929 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021929
Domain Number 1 Region: 1369-1501
Classification Level Classification E-value
Superfamily PRC-barrel domain 7.69e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000033
Further Details:      
 
Domain Number 2 Region: 212-312
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000188
Family Calponin-homology domain, CH-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021929   Gene: ENSTNIG00000018750   Transcript: ENSTNIT00000022165
Sequence length 1505
Comment pep:novel chromosome:TETRAODON8:4:7188435:7198975:1 gene:ENSTNIG00000018750 transcript:ENSTNIT00000022165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVPLELYDSARAKIEANLRWLLAKDYGIDHIPVDLRDPFYTDQYEQEHIKPPIIRLLLSG
ELYCRVCGLILHAEQAALLQSHQAVIQALSRKGVYVLQPDNTPVSELDLRSAPIKMSAHV
HLIDALMMAYMLEMISVEKVVSSVKHFSNLSAKELPFDLEDAMLLWINKVTMKMREILEK
ELKMKHHLLESPSHQKMRYRREPLSGRTLQHFPLLHDLLRDVSDGMALLAVTHFYCPELV
KLEDICLKEVPSIADSVYNIQLLKEFSNEYLNKCFHLKPEDMLYSPPVLKNNLMVFIAEL
FWWFESVKPEFVQPRELQEIRDVRFLLQPQGTRPQVPSIHKHHFMTSSNSADTLASSISP
ELRYPPVFSHTFCSKLFFHELEFIGSSKPTSSTSASLLPIQHRYQKLPEEGMLELRKRSS
SVTHADLQPQGSFLARSDRRSRPLSQLPPYALHYGPDDEADAISLARSISKDSLASNMTG
ITPKHLLRSGPQRSQHRLSGQSLLSHMHIEDQEEEIEEEELVAVIHPSSHARSRLASAME
QDELDIPKVTGSSKLPQTYCSPYDDMDRFAAEHPADRYCLEPLMPAVPKAAKEKSISLNK
EEESGENHHRAAATAARKVATSFAATPQRKAAGGAQAKVTSSTPPRLVEPGSVRPPVEGS
VGQAEKKEPQGFFLHLSGESECRSTFSLDAGQDSDSDIADLDEDDDDEEEEAEEDGELCD
AAEGESAKLREDLKVSEREDKEDASGQSSPCLSTASWASSCSASASSNIKMTSFAERKLL
KLGLRDGFSSTSSSQKTTPDGSEVLACPPWQPRSDCTSGWMGKEPVLPLSPSVVPSELLQ
LHMQLEEQRRAIEYQKKKLETLSARQRLKLGKAAFLNIVKSGGKSDTLPLPLKHSESAEF
ADRGEGKTPFCKDDSCLDALKVQAKTGQTEGGGRGSDNRLSNVNGAEPDRNECSHSIDLL
NEAISSIQQQMMQLSLQQDLLMKHVVSPPEQAESGPSATSDATPPAPSTSDPRCFAVHFV
DLGDSSTPVRRPPKLSSGQRRKTERKQSEDGTKTPTVKSNAGLSAQKDQKIEDVVESSKM
EKSIQRNATFRVHSDVSTQHGPEQHLDSVSSTPVHQPPQQTAQPVGNQAVNSGKEAVGGS
ETTRLKGQLIEVDLSELKDPEEGSAEMAEPPADSEPKNVLGFFFKDEEKAEDEMAKRRAA
FLLKQQRKAEESRLRKQQLEAESELKRDEARRKAEEDRIRKEEEKARRELIKQEYLRRKQ
QALMEEQGLVKPRPRMKSGRSRPKSLHRGESNSLSRGAATPDLSGSHRGSTLSLATEADS
VISEESQRAGSVCSMDSFPVLSRASSRNMERDWDNGSIASSITSVEYNEGPKLFKEPSSK
SNKPIIINAIAHCCLAGKVNESQKNAVLEELERCESNHLIILFRDGGCQYRAIYSYSPDT
EEMVKFTGTGPRAIGHKMVDKLYKYSSDRKQFTVIPAKTVSVSIDALTIHNHLWQVKRPG
SARRK
Download sequence
Identical sequences H3DN31
ENSTNIP00000021929 99883.ENSTNIP00000021929 ENSTNIP00000021929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]