SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022175 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022175
Domain Number 1 Region: 35-168
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-46
Family Calponin-homology domain, CH-domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 2344-2463
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-32
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 1520-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 4.82e-25
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 1205-1357
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-24
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 5 Region: 578-709
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-23
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 6 Region: 1679-1783
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-22
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 1733-1886
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-20
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 8 Region: 405-506
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-20
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 9 Region: 1115-1237
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-19
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 10 Region: 1019-1146
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-19
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 11 Region: 507-614
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-18
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 12 Region: 1952-2061
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-17
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 916-1037
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000475
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 14 Region: 799-885
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000272
Family Spectrin repeat 0.00076
Further Details:      
 
Domain Number 15 Region: 1368-1463
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000981
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 16 Region: 720-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000489
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022175   Gene: ENSTNIG00000018985   Transcript: ENSTNIT00000022413
Sequence length 2496
Comment pep:novel chromosome:TETRAODON8:16:6523215:6548480:1 gene:ENSTNIG00000018985 transcript:ENSTNIT00000022413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANASSDLDNAEAQRQLNNNNRPIGSGFWETECTSSKLFECSRIKALADERDAVQKKTFT
KWVNSHLSRVSCRISDLYNDLRDGYMLTRLLEVLSGELLPRPTRGRMRIHCLENVDKALQ
FLKEQRVHLENVGSHDIVDGNHRLTLGLIWTIILRFQVERNRNHTQKHMMTRKASNVLCQ
GNRMLADVTTRAPNKHLKCYFQGRLSELPHHHSAITHSVCWTKPKCHLRPSSLRVACAFC
FALQQGHTLTHAPRPISLRTHKHGEAHMHRTRISTCAPQFQAPAALTQKYKKRKSKCHVS
VTPQWYLCSHTLYTISIFLLKCSQCSVYCSKLHMLSMSTFVQIQVIKIETEDNRETRSAL
VPDEDSRVSDVNYTWEFHQYTSVSMNPFKASDIRRSTSKISPLAFDHKTTMRQAWLNENQ
RLVSQDNFGYDLPAVEAAMKKHEAIEADIASYEERIGVVVELSAEMEAEAYYDIRRILAR
KENILGQWKLLKELVAGRRTRLEKNLSLQKIFQDMVYMIDWMEDTQVQLLSKDYGKHLLE
VEDLLQKHSLQEADIAVQAERVESLNKAALKFTTIQGYQPCDPQVICNRVNHVSSCLEEL
KQLASKRCTDLEESRQLWAFLQELEESDAWIREKSSILGAQGFGKDLTSVLKLLQKHKTL
AGELLAHRSLLQNTIKQGKQILSEKSFGTTGIQEHILELKNQWKRLEDQAGQRLGHLQEA
LNFFQFSTEMDDLVAWLQDAYRLVSSEDFGHDEYSTQSLLKKHAEFLVFLVFARLERRDE
GPNCGGQEGRFPPSNQVLDNCIEAEKIIDRYEALASDLLDWIEKTIAVISNQKEAHQATI
LCALWLIHEKGNLEVLLFTIQSKLRANNQKPYVPHDGKLISDINKVIHPSICVHYXLKPK
RSDSDHIKFCAVFSLPRWNSIVELVEQKKNQLNSMLRLQNYLLECVEIKSQIQDKRKAID
STQYMGSDLGGVMALQRRLSTMEGALSVLEPKLLHLQEEAENLATAHPSRAMEVLVPFDD
ISVEWEELKHTLQGCEDSLMVASRLQSFIQDLDSFLTWLVQTQTVAASDQLPNDLEEAET
LINKHAALKEEIGRYEEDYERLQSMNELLDSDEAPLPQAALQQWLQKLDVGWNKLLEMWE
SRREVLVQAHIFHLFLRDVKQAESLLNNQESALAHVELPTTVETVEAAIKKHKDFTTSME
LNLHRIKAVIEAGESLISQNNIYSERIRERIDTLANRGNQNREMAQKWLEKLNHQWELQR
FLQNCHELGDWVYEKMLMARDGSRDESQKLHKKWLKHQAFMAELAQNKDWLDKIEKEGQQ
LMQEKPELSPVVRRKLEEIRDCWQDLESTTQAKARQLFEANKADLVVQSYESLDQRLNQL
EDQLAYVDQGQDLTGVNNQLKKLQTMENQMEDWYKEVGLLQVQAATIPQQTQRNETVSER
QTAVEARMVRLIEPLKERRRILLASKELHQVRRDLEDEILWIQERLPMAMSQEHGSTLQE
VQQLMKKNQMLQRELQGHKGRIEDVLERAGIIASIRSPEADSVRTGHDQLAQLWNLLWVE
TERRQLVLDAMYQAQQYFFDTAEVEAWLSEQELHMMNEEKGKDEPSTLQLLKKHLVLEQT
IEDYAETIGLLSQQCRQLLEMGHPDCEHISRRQSQIDRLYVSLKDLVEERKSRLEQQYWL
YQLNREVDELEQWIAQKEVVASSPELGQDFEHVTVLQDKFTKFATETGSVGQERVTAVNQ
MVDELIDYGHSEAATIAEWKDGVNEAWADLLELMETRSQMLAASHQLHKFFSDCREILAQ
IDDKHRRLPEVRAKQGNSANTNTLKRLLHSFEQDIQLLVTQVRHLQESAAQLRTVYAGEK
AEAIACCEHEVMQSWKELLTSCEECRVEITTETDKLKFLGMVRDQLIWMDSIICQIGTGE
KPRDVSSVEVLMNYHQSLKSEVEARSRSTLECIEMGKTLLAVRNPAAEEIKEKLEKVVAK
QHELSEKWDKHWEVLQQLLEVHQFAQEAVVAEAWLTAQEPLVNSSLLGESVDEVEQLIRR
HEAFRKAAATWEERFSSLRRLTTVEKLKAEQGKLPPTPLLGRKVFLDPQDAIPSPATLPR
LPVSPVARQTMLGSTVASYTPVMNGSGYRHTLEPRHAGAGVVGVAAGLGQPSPSSIASVA
TAAMLVSANQMRERANTIKEQATKAVEQLIQARRDELPQEVWREHAERRERRTLERQTSS
EQEGHGGLDVRRRERDRHRLERQESSEHDTGHSDRRSAGGERRSTMAEIVEQVQEREAAQ
VCMPCSALQARGEVPRLPNGFPEKSSRPDRPRARDRPKPRRRPRPREAGDTTARRSRSAP
AQSSPAVPQPPTHTAHHEGFLFRKLDIESLKKSTNSRSWVNLYCVLNKGEIGFYKDAKNT
STPYNNEPLLSLSHCHCDITNGYKKKKNVFTLKTKDGSEFLFHAKDEEDLKAWVNNITTS
ISEHEEIAKRGQPQPTTSSTDEGTRREGSKADNRSE
Download sequence
Identical sequences H3DNS4
99883.ENSTNIP00000022173 ENSTNIP00000022173 ENSTNIP00000022175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]