SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003730 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003730
Domain Number 1 Region: 784-902
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.9e-20
Family Phosphate binding protein-like 0.00018
Further Details:      
 
Domain Number 2 Region: 243-405
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000267
Family L-arabinose binding protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003730   Gene: ENSTBEG00000004285   Transcript: ENSTBET00000004316
Sequence length 1108
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3459:52590:220815:-1 gene:ENSTBEG00000004285 transcript:ENSTBET00000004316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWLLNRVCLLLPPPCALVLDGVPGSSSNPQPCQIFLIVNAVSVGAVPFQWDTGPR
MFGCAPDGMEGPLGYEQKPASLRPPAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPLHLQLSLEN
SLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITANLSST
EDLLNFLQVQLESIKNSTPTMVMFGCDMESIRRIFEITTQFGVTPPGLHWVLGDSQNVEE
LRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAIATATMIQPELALIPSTMNCMDVET
NLTSGYLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLH
HPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAFIMDK
ALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDK
WYKVVPCGKRSFAVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRLHRALNTSFAEEKQQCFKTKRVEKRSNMRPSQFTVWNTSNLSHDNRRK
YIFSDEGGQNQLGIRTHQDIPLPPRRELPASLTTNGKADPLNVARTSVMQELSELEKQIQ
VIRQELQLAVSRKTELEEYQRTNRTCES
Download sequence
Identical sequences ENSTBEP00000003730 ENSTBEP00000003730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]