SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005301 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005301
Domain Number 1 Region: 444-592
Classification Level Classification E-value
Superfamily HCP-like 3.01e-30
Family HCP-like 0.0011
Further Details:      
 
Domain Number 2 Region: 563-698
Classification Level Classification E-value
Superfamily HCP-like 1.15e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 116-169
Classification Level Classification E-value
Superfamily Kringle-like 1.17e-19
Family Fibronectin type II module 0.00085
Further Details:      
 
Domain Number 4 Region: 360-416
Classification Level Classification E-value
Superfamily HCP-like 0.000000000327
Family HCP-like 0.0098
Further Details:      
 
Domain Number 5 Region: 178-255
Classification Level Classification E-value
Superfamily HCP-like 0.0000000562
Family HCP-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005301   Gene: ENSTBEG00000006127   Transcript: ENSTBET00000006157
Sequence length 792
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_843:1223210:1312130:-1 gene:ENSTBEG00000006127 transcript:ENSTBET00000006157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSLPSDESVKGPTTAGRVVAGQIF
LDAEESELEPSIQEEDSLKSQEGEGVPEEINFLDSPNPENKDYEESKKVRKPALTAIEGT
AHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATSYDYKTDEKWGFCETEEEAAQRRQMQ
EAEMMYQTGMKILNGSNKKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNIHA
AKEMFEKLTEEGSPKGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLI
QYYQFLAEKGDVQAXVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKXXX
XXXXXXXXXXXXXXXXXXXXXXXGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQG
WVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHT
AVELVKHVCERGRWSERLMAYHSYKDGDYNAAVIQYLLLAEQGYEVAHSNAAFILDQREA
TIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQH
SAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGIVYFLQYIR
ETNIRDMFTQLDMDQLVGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPVPRPPGPRPAPP
QQEGPPEQPPPQ
Download sequence
Identical sequences ENSTBEP00000005301 ENSTBEP00000005301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]