SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005841 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005841
Domain Number 1 Region: 423-536,658-803
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-57
Family Phosphate binding protein-like 0.00000000189
Further Details:      
 
Domain Number 2 Region: 29-408
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.3e-47
Family L-arabinose binding protein-like 0.014
Further Details:      
 
Domain Number 3 Region: 560-655
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000785
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005841   Gene: ENSTBEG00000006752   Transcript: ENSTBET00000006768
Sequence length 892
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_2004:34122:373726:1 gene:ENSTBEG00000006752 transcript:ENSTBET00000006768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQKKMGQSMLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERSLKT
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVTGSRKAGYWNEYERFVPFSDQQISNDSASA
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAHVRIKYKLSIVGDGKYG
ARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSK
PGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPN
EFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERM
VSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADG
VARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLA
VKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVA
LIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences ENSTBEP00000005841 ENSTBEP00000005841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]