SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009117 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009117
Domain Number 1 Region: 505-760
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 204-443
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-50
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 4-153
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-34
Family YWTD domain 0.0000191
Further Details:      
 
Domain Number 4 Region: 943-1065
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000000183
Family YWTD domain 0.0014
Further Details:      
 
Domain Number 5 Region: 762-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1196-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1117-1157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 460-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 1158-1194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 156-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000709
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1075-1128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000706
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000009117
Domain Number - Region: 808-869
Classification Level Classification E-value
Superfamily YWTD domain 0.00034
Family YWTD domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009117   Gene: ENSTBEG00000010510   Transcript: ENSTBET00000010541
Sequence length 1484
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1827:56407:203353:-1 gene:ENSTBEG00000010510 transcript:ENSTBET00000010541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGL
TLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSI
LACNKYSGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQ
CACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDY
DPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTSQIAHPDGIAVDWVARNLYWTDTGTDRI
EVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNT
SLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYW
TDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATSVHRITGSNPCAEENGGCSHLCLYRP
QGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASAL
DFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTN
RIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLV
PNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYW
TDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAV
PVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNV
RAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYMYFTNLQERSPKIERAA
LDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSXXXXXVLEDSLQPVG
LTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQ
DNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWR
CDGFTECEDHSDELNCPVCSESQFPCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLID
QFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGT
IYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSL
SIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSP
STHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMPSVATAKGYTSDLNYDSEPVPP
PPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSTBEP00000009117 ENSTBEP00000009117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]