SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009291 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009291
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-31
Family FKBP immunophilin/proline isomerase 0.0000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009291   Gene: ENSTBEG00000010764   Transcript: ENSTBET00000010746
Sequence length 108
Comment pep:novel scaffold:TREESHREW:scaffold_18111:1019:1345:1 gene:ENSTBEG00000010764 transcript:ENSTBET00000010746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGQVENISPGDWQTFPKGGQTCVVHDTRRLEDGKKFDSSQDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQTAKLTTSPDYAYDATGHPGIIPPLATLIFHVELLQLE
Download sequence
Identical sequences ENSTBEP00000009291 ENSTBEP00000009291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]