SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010882 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010882
Domain Number 1 Region: 531-824
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.82e-55
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 289-439
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-37
Family L-arabinose binding protein-like 0.0000275
Further Details:      
 
Domain Number 3 Region: 24-188
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-29
Family L-arabinose binding protein-like 0.0000103
Further Details:      
 
Domain Number 4 Region: 844-903
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00000000000000644
Family Adenylyl and guanylyl cyclase catalytic domain 0.0027
Further Details:      
 
Domain Number 5 Region: 995-1039
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00000816
Family Adenylyl and guanylyl cyclase catalytic domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010882   Gene: ENSTBEG00000012526   Transcript: ENSTBET00000012558
Sequence length 1045
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5887:66695:100142:1 gene:ENSTBEG00000012526 transcript:ENSTBET00000012558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRTL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVRFASHRHLPLLT
AGAVASGFATKNEHYRTLVRTGPSAPKLGEFVVTLHGHFIWSTRATLLYMDVSTDDRPHY
SIEGIFEALQGSILSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVLVITYREPP
NPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGSREDGL
RIVEKMQGRRYQGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWTG
RPIPWVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLM
LEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGH
FKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRG
SLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITD
YGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSG
PFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFGQI
KGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSV
AEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDV
YKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEIHVSSTTKDALDELGCFQLELRGD
VEMKGKGKMRTYWLLGERKGPSGLL
Download sequence
Identical sequences ENSTBEP00000010882 ENSTBEP00000010882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]