SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011111 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011111
Domain Number 1 Region: 643-813
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000727
Further Details:      
 
Domain Number 2 Region: 129-283
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-34
Family DBL homology domain (DH-domain) 0.00095
Further Details:      
 
Domain Number 3 Region: 299-368,426-460
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-20
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 4 Region: 503-609
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000136
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011111   Gene: ENSTBEG00000012784   Transcript: ENSTBET00000012823
Sequence length 859
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_4712:106810:261145:-1 gene:ENSTBEG00000012784 transcript:ENSTBET00000012823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLSHRGLPRLSWIDTLYSNFSYGADDYDAEGNEEQKGPPEGSETMPYIDESPTMSPQL
SARSQGGGDNISPTPPEGLAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMKPL
KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ
LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEXXXXXXXXXXXXXXXXXXXXXLLYKPI
DRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR
QLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSP
EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL
NSPTIPFRIHNRKEKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCF
KLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKT
RVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDP
QTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKV
PYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGT
LKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLK
RVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH
PPISFAELKRNTLYFSTDV
Download sequence
Identical sequences ENSTBEP00000011111 ENSTBEP00000011111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]