SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011849 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011849
Domain Number 1 Region: 267-400
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.54e-43
Family Eukaryotic proteases 0.00000268
Further Details:      
 
Domain Number 2 Region: 58-156
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000471
Family Hepsin, N-terminal domain 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011849   Gene: ENSTBEG00000013667   Transcript: ENSTBET00000013678
Sequence length 401
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_684:51054:62945:1 gene:ENSTBEG00000013667 transcript:ENSTBET00000013678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVSPAD
ARLMLFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALAHSELDVRTAGANSTSGFFCV
DEGRLPHAQRLLEVISVCDCPRGRFLAAICQDCRLPVDRVGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXYIQPVCLPAAGQAPVDGKICTVTGWGNTQYYGQ
QAGVLQEARVPIISNDVCNGPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSIS
RTSRWQLCSIVSWGTGCALAQKPGGYTRVSDFREWVFQAIK
Download sequence
Identical sequences ENSTBEP00000011849 ENSTBEP00000011849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]