SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CTRT_03890 from Candida tropicalis MYA-3404

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CTRT_03890
Domain Number 1 Region: 9-67,135-285,313-446
Classification Level Classification E-value
Superfamily ARM repeat 1.59e-17
Family HspBP1 domain 0.078
Further Details:      
 
Domain Number 2 Region: 1015-1288
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000628
Family Tropomyosin 0.00028
Further Details:      
 
Domain Number 3 Region: 1909-2110
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000222
Family Tropomyosin 0.002
Further Details:      
 
Domain Number 4 Region: 763-1012
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000497
Family Tropomyosin 0.0012
Further Details:      
 
Weak hits

Sequence:  CTRT_03890
Domain Number - Region: 1542-1699
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000201
Family HBL-like 0.034
Further Details:      
 
Domain Number - Region: 1718-1958
Classification Level Classification E-value
Superfamily Tropomyosin 0.000523
Family Tropomyosin 0.00081
Further Details:      
 
Domain Number - Region: 1403-1489
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CTRT_03890
Sequence length 2136
Comment | CTRG_03890 | Candida tropicalis conserved hypothetical protein (2137 aa)
Sequence
MEYLNNILGQSNQVQSVEEAIPTLCNRLQHATMSSDRRSAVLGLKSFSRQYRESVVEHGL
RPLIATFKKDIDNPQIIKPLLETLLILFIRGESDEDQTRGWISQQSRLQNGKYPSPLLME
DVSLDQLSLWIADALIQDHDTLVQLIENLSEASDYHTKLYTIQLLESLTASRGSRTKETL
LTIPTAMSTICSLLNDSNEPVRNEAILLLMALVNDNFNIQKLVAFENTFETLFDIIEEEG
GIRGSILVQDCLTLITNLLQFNASNQKFFLETQCVPKLAGLLGEPIDETGDPELLDEDGF
PIAPPPIVWTDQRIQNMIIALEICRLLVSEDNELVLQNQDKLFQAGIHYILLKLVFSPLT
ENLVRSVALLTTGDAISGNANIQLEFSKVDVPYMDPSLPSQIQTYDRPISVPLALLNWCL
FINSVHAFDIRVSAAFCLNSYFKDNNESKLAFLNDQIKAYTNPNYYEDLPKDELPAVNGN
SIPTPFGNIFKTLMDYDADMKLNPYTVWFASTILVYLFVEDIENKEIAREVKTGDEEAGE
EVMNSIQAMSGLLLTTLENMDQRIAMGYLMLLTIWLYEDFNAVNDFLSDQSTVKSILASL
SNNTSDQNVLVQGMATILLGVAYEFSSADSPLPRAELHALLVKSLGKDNYALKIKQFKAN
PVFKDFEQASSLTFTQDDTGLPNVYFTTNYVDLIKENFLRIKRALTHDPLGEPRGKISYE
LFEELDSKVSDLTKELKSEKEKAVNNDKTLNEKISELSDLSNKLELKLEDNQKELAKVKE
DHAYVSEKLSTTTQNLSTMETSKKEFETLSQKYHKELQEALKKGSSSSDLSKQLKEKLDT
TEQAKKKLEDGINNMTRDLFQFKKQKNEGEQKIKHLEGELKKFNNELERTKQNYENQIKN
IQSANDDFKRKIQELNSQLDGVLKDKESTVQELEEKIRDAEENNEHLMDKLRSASVAFNE
LKQSKLDSEEETAQTKKQLEEVNGKIEELQKSLDDVQLEKTQLKDKLANLENSTSEKIKS
LESELESIKKSSKEISSEKSKLVEELEKLKQEVDAKDKKLASAEEESKSKIDDLNSKIQD
LEAKLKESEDSHSSTKDLHSSLSDALDKLKTEYESTKTSLNEKLSAKTEEHSKVASELES
KLKHILHLKEEHQKEKAQLEEKHKEVSTNLENVTKELKQSEKNLSSVNQRHDELSDTLKN
HESKIEDLETTVEISKEKSKRLIQDIEDLKKEKIDLEKTIKDHVDSLEAKSTEVSTAERK
IEEVNKELKNLQEEKDSEINKMKELQNEKAKEVEKLMKDLATAKLSTENITKEMNGKLKE
LQDANEIEVRELKTKLSTKEDELKGIQAKFDIALAEKEEIDNSTSKTISSLKTEIDDLKK
QIAKEKEAKKEIDEKVKILSEEVDKKSNELDSKDKELQLTKDELSKLSNDLVSVKSELTK
VQDERKSLSEEVTKAKSVIDKKSALVVSLEKEKSDLESNLKSTKSELKELQNKYKKETAT
LNERISEKEKEISSLSTELKDRISEVEKERAMLSENSETVIKEYGDKIKSLEEKIKSLKE
THSKDTSKHNEEKSTLKSSIEKLTSEHDSTKSSLEEKEQELNKFKAELKKTVDTAKEAVD
EKEKKIDELSSEVKTLKSDISVKEEEIRKSEADYKKLSVEKSVFEKKLTNNTNELNETVK
KLEDAKASLAEVGKLKDELTAELDTLKSTSSSTSTELNELKKEIKNLSNEKSELSSSLEI
KTKDFDDQVTKHTELSGKFDELTKKLELKHSELESTKKMHSDTASKLKALEKELETVNAK
HSEVSDTVESKTNEIAKLNDQINSLKSQQSDANKEKSSTISKLQETVKLLESEIKEKKVS
LENYADLDNKLKEKESEVKTLGESKDKLQSQLDDLKKELEGALVYKKELDTTAAKLSESE
LELKSASEKVEQLSAAKSKVEEELASVEKKHSELVKSVEVNSSDSAKVQSDLDEARKKVA
LLEDELAKVKSEHEIAKTQISEKEKVEAEFANLQKCQKDTESKLEVVEKEKDDISKELEK
EKSANEESVKQLKSIEESSKSSSEKYELEIKKLKDKLNKYVPKSDLDDLMLLMSDLDEKN
KAYKKKLKSLGEDVSSDEESDEDDSDEDDEDEEDEE
Download sequence
Identical sequences C5MCD9
XP_002549593.1.44731 CTRT_03890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]