SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PTRT_04841 from Pyrenophora tritici-repentis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTRT_04841
Domain Number 1 Region: 311-567
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000412
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 2 Region: 1089-1339
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000504
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 3 Region: 797-987
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000464
Family Tropomyosin 0.00067
Further Details:      
 
Weak hits

Sequence:  PTRT_04841
Domain Number - Region: 510-724
Classification Level Classification E-value
Superfamily Tropomyosin 0.000229
Family Tropomyosin 0.0064
Further Details:      
 
Domain Number - Region: 984-1111
Classification Level Classification E-value
Superfamily Tropomyosin 0.00124
Family Tropomyosin 0.0046
Further Details:      
 
Domain Number - Region: 715-818
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTRT_04841
Sequence length 1603
Comment | PTRG_04841 | Pyrenophora tritici-repentis predicted protein (1604 aa)
Sequence
MAPGSKTKDLDRPNANIRTASGLENILPASFINMQKCAGDIPKDATSQPSSRAMSRTRPS
ATPLSGSSLSRSVSSMTDSFMLDRRRSPSTKPLQSEHDGGENSEVPSPKAGDAPTVISNW
AHLSYMKTQRNTLRAELKAHQIAGAEAKRSVTSLRRLAFRMAVNISVKEKQITNTARNLA
RSRTNSYLEGKGAQRRVDELKRALKIEEERNKEILEALERASMLTLEYSTPQDEPQHRPE
HSFFSPPPSPPTRSSVPGSPISEPRTPTRPSPSPWNDVDFELTPRIGSVAEIRTSDSRLI
RAKRESDRALAVCRRRIEQLQHECEESREDSRFLEITREGLEQEIRNYQSQIAVLERSRF
AVEKTLQSTKSQLFTVIDSEDRLIQELQAKSEELAAWEGRGGDMQGRIDALQKENTDLDE
RLRDQSAQIRELEIRTAILDESLQSCRSKLEAAECYETSLQERLTEKEQTCEGLKKRLDR
GRQHVASLEQKITGYEADAAEHLRKIELDGHDISELREQLQNSQIMNQNNENALATLKEE
MEVLQTKLQSESDARDALATELETMRTEKTGVEDELRVMTESWDQEAAAKVKLLVELEDL
RKSYDTAEASLVQALGRIESLEVADATAQATAETLRAEKSKLEADLRDTQQLLSKLYEDV
QTRDSEIAELQSAKKDYEQRLQDSEQQVLSLAKELEQTKTVMRKTDEQHAADMAKSDEHL
RELESSILNLQSALATSEKLEASLQEELRLVRDSKDSVESELGDAMRSKAELQDRVDYVQ
SQLISTAGERDGLQANVTNFEEQLRTSADTQASLEEQLAAITDEGASLRCRVSELETELE
DHRDAKSKVEEALSIAQMDGEASGTELADLHARIEESEAATQEAQAGLYHALRSKSDLEN
QLQSARNKLKKVESKASDVRSRLSTIHEEMVELRQSKEKADKDLKVVSAARDALDQDLQH
SRSQLQAIQAKVSQLETRLSSTEEELEAMCRAKAAVEKRLKETLEATAELNKELDTARKE
NADMRDRLDSMTTSNANLKEDLVVTRSQLAEIDLENTHLTSKLCDAEEELDTLRQLKDDV
EGRLSEALAASTNAEQSLALTRARLEELESRDSRMVAELAQTRAEMDTLAKTKVELESKL
DAAENNTGSLQADVSSMRSRMAELESNTATLLSQLAASGKELEELRSSRALLESSFQTAS
ARSGYLETELHAAQMRLSIAEAESLEAMNRFLLANKELASLRDENVKLAKSRKELLTRLA
TAEEELNTARENNIRLGAFLERVESDMTKAQTAVEETEKRYHEFVQSAQAKLEAAESSKL
RFKDRLTERNNELETLINENSDLHQQIGDQTRELGALKVGKGKLVEELSKKEKYIEELGS
SAEKRLKSMNSAYNGLRQKFEEQQSQQRRLDDDHETALRLEAELEKKMTEIEEMHHNQEE
PVASFAALEKEVENLKNDKRAFEKLVATLYEKMRHLDVLDEWTEQGETNRAGSQRHITIQ
DEPYDTAPSSPITISHHDEDDAWTRQIEEARMQRNEAALLLSGMKKFRDNLKKTLRDTDA
HLHRLEKDIKAKHTPNLLRKKSRPLNSPTPATSTAIAIDESWY
Download sequence
Identical sequences B2W5E1
XP_001935174.1.10593 PTRT_04841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]