SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 282948 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  282948
Domain Number 1 Region: 5-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.51e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 282948
Sequence length 113
Comment $ JCSG $ SQ10651 $ PDBT19370 $
Sequence
MFPYKIVDDVVILMPNKELNIENAHLFKKWVFDEFLNKGYNKIFLVLSDVESIDSFSLGV
IVNILKSISSSGGFFALVSPNEKVERVLSLTNLDRIVKIYDTISEAMEEVRRK
Download sequence
Identical sequences G4FER7 Q9X0H0
gi|15643839|ref|NP_228887.1| gi|15643839|ref|NP_228887.1| 243274.TM1081 282948 NP_228887.1.35502 WP_004080402.1.100023 WP_004080402.1.29620 WP_004080402.1.43545 WP_004080402.1.45724 WP_004080402.1.51363 WP_004080402.1.56403 WP_004080402.1.79805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]