SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 283708 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  283708
Domain Number 1 Region: 79-328
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.92e-56
Family L-arabinose binding protein-like 0.00016
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.16e-18
Family GalR/LacI-like bacterial regulator 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 283708
Sequence length 328
Comment $ JCSG $ SQ11382 $ PDBT20130 $
Sequence
MPTIEDVAKLAGVSIATVSRVINGSGYVSEKTRYKVWKAIEELGYKPEISAKLLASKGKL
FNIYVFASKRILSPLQNNGILGEFYGVIIRAIEENCGRLGMNVELKMLENFSESNGADGY
IFIGGDLSEKTLKEIKSRKKPFVLVDHYIPGERVDCVISDGYDGAVYATNYLISKGFKRI
VHVHGPLHPYGFKMRYDGYKDAMEKAGLMPRFYECDDTEEGTRKVIDIMLNSYGTPEAIF
TSNDSIAFWVIKRLKEHNIKVPDDVSVIGFDDIVDAENFDPPLTTLRVFKYEMGCLACKR
LHELLTGINPHPVRILVFTQFVKRKSTK
Download sequence
Identical sequences Q9X2H1 R4NSK4
243274.TM1856 gi|15644599|ref|NP_229652.1| 283708 NP_229652.1.35502 WP_004082407.1.29620 WP_004082407.1.45724 WP_004082407.1.51363 WP_004082407.1.56403 WP_004082407.1.79805 gi|15644599|ref|NP_229652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]