SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2907S from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2907S
Domain Number 1 Region: 443-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2907S
Sequence length 550
Comment $ CSMP $ SQ14601 $ PDBT332423 $
Sequence
MPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAG
IVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIE
YIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIG
IVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYVLADGSQGNG
IPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGTKHK
ANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLVLAP
LLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVLFDMVIAISV
GIVLASLLFMRRIARMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRI
VILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFF
PNRRAAMADL
Download sequence
Identical sequences A0A024KUG5 A0A0A0F9V1 A0A0A6ZS99 A0A0A8U6M6 A0A0E1LWD6 A0A0E1SZE6 A0A0F6C390 A0A0F6MCI5 A0A0H3EV52 A0A0H7K7C0 A0A0M7NYN1 A0A140NCK5 A0A142H246 A0A222QJV2 A0A2H1BN13 A7ZKX9 C3TD17 D7XUS8 D7Y8Y1 D8E309 E1IMW0 E1JB61 E6BLT5 I0VNJ9 J7QKS1 L2V4V8 L3CDS4 L4VUE2 Q0T5I9 Q32H01 Q3Z0S4 S1DYX2 S1F904 S1H0A8 S1ICH4 T9DE47 T9T5K3 U9XGJ2 U9Y4X1 V0AIW3 V2RGR7 V8FDN3
gi|15830965|ref|NP_309738.1| gi|560156368|ref|YP_008849083.1| gi|378713418|ref|YP_005278311.1| gi|386705101|ref|YP_006168948.1| 155864.Z1977 300267.SDY_1255 300269.SSON_1972 331111.EcE24377A_1353 331112.EcHS_A1311 373384.SFV_1220 386585.ECs1711 469008.ECBD_2415 481805.EcolC_2420 gi|110805211|ref|YP_688731.1| gi|74312454|ref|YP_310873.1| gi|157158365|ref|YP_001462458.1| gi|378713418|ref|YP_005278311.1| gi|82776546|ref|YP_402895.1| 2907S APC797 gi|387882204|ref|YP_006312506.1| gi|170020427|ref|YP_001725381.1| WP_001300632.1.54023 YP_402895.1.10455 gi|15801435|ref|NP_287452.1| gi|253773795|ref|YP_003036626.1| gi|157160711|ref|YP_001458029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]