SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 354631 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  354631
Domain Number 1 Region: 100-314
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-53
Family DBL homology domain (DH-domain) 0.0000944
Further Details:      
 
Domain Number 2 Region: 330-446
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 354631
Sequence length 541
Comment $ JCSG $ SQ12456 $ PDBT21257 $
Sequence
MVAHDEIGGLLPIKRTIRVLDVNNQPFREQEEPSNKRVRPLARVTSLANLISPVRNGAVR
RFGQTIQSFTLRGDHRSPASAQKSFSRSTVPTPTKRRSSALWSEMLDINMKESLTTREIK
RQEAIYELSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLA
RIGEATKPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHRDVQLLEEAILIIQGVLSDIN
LKKGESECQYYINKLEYLDEKQKDPRIEASKVLLCHGELKNKSGHKLYIFLFQDILVLTR
PVTRNERHLYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFGNSDKAKNIFRVRFQDPS
PGHSHTLQANDVFHKQQWFNCIRAAIAPFQRAASPLELQGLPDLHEECEENNPSAGNLRA
QRRSCVVPGVMQIDEESALDCGSSVQTVEDTRNMKAQRPQPGLRRARDKAQSGGKKKETL
V
Download sequence
Identical sequences Q3USZ7
NP_001040624.1.92730 ENSMUSP00000097529 354631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]