SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 359650 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  359650
Domain Number 1 Region: 1-290
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-43
Family Extended AAA-ATPase domain 0.000049
Further Details:      
 
Weak hits

Sequence:  359650
Domain Number - Region: 308-366
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00261
Family Cell cycle transcription factor e2f-dp 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 359650
Sequence length 387
Comment $ JCSG $ SQ82546 $ PDBT23924 $
Sequence
MLFNTRPKEDRKDLYDREKEIEMIKDSIARGEWIAVLGMRRIGKTSVVNVAVKEIGAIKV
SINLMRIHDSRKKQYPKHVLISLLIEEINEAIKNYTILGKVAKLLSNILGVEEIQTNKVR
AKLTKIRGTDITYIIREMDSIARDNKKQLVIILDEAQELAKVNGLDFPSIFHDVYDNCKN
TVIIFTGSMVKLIEKTLKNIEYTEPFFGRYIRKITLGRFLPEQSREFLEKGFEEEGIKVD
ESVIDEAVKRLDGIPGWLTLFGSEYTFSAKMGTKPRIDEIIEKAINEVRNEARNFIFSTQ
SPLRYSAVILALDRLGGKGELHEIVKVSSTILNENIPEPRVYEILNRLVEFDFIERREDN
EYYLHQDEPNRKGLILAAKDSPASYSI
Download sequence
Identical sequences A0A0E3MDQ1 C3MMC2 C3NBK5 D0KPS8 D2PI77 Q97X15
gi|15898739|ref|NP_343344.1| 273057.SSO1939 429572.LS215_0665 439386.YG5714_0701 WP_009992596.1.13477 WP_009992596.1.14611 WP_009992596.1.22626 WP_009992596.1.34992 WP_009992596.1.43719 WP_009992596.1.57434 WP_009992596.1.66040 WP_009992596.1.66823 WP_009992596.1.8449 WP_009992596.1.93834 gi|227829611|ref|YP_002831390.1| 359650 gi|284997174|ref|YP_003418941.1| gi|229578514|ref|YP_002836912.1| gi|384435075|ref|YP_005644433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]