SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366067 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  366067
Domain Number - Region: 27-79
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000883
Family DBL homology domain (DH-domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 366067
Sequence length 111
Comment $ JCSG $ SQ115430 $ PDBT27215 $
Sequence
MQNNTIGLGLNLLSSLTNIAKTDTNIDHNYINTFSKVIDFFYKTYISTLKSMETAESTKI
FEEIQDILKYNIEIIEAISTDKSKRIITSLKATRNKIMKEYIKILKRGENA
Download sequence
Identical sequences A0A0E0SS88 A0A0H3C278 A0A1L6VRF6 E4QQP0 H7C7Q0 Q44825
224326.BBN25 224326.BB_L25 224326.BB_M25 224326.BB_Q32 224326.BB_R25 445985.BbuZS7_N28 445985.BbuZS7_R25 NP_051272.1.46978 NP_051316.1.46978 NP_051402.1.46978 NP_051438.1.46978 NP_051494.1.46978 WP_002658486.1.100172 WP_002658486.1.100372 WP_002658486.1.1709 WP_002658486.1.22354 WP_002658486.1.23946 WP_002658486.1.30682 WP_002658486.1.3534 WP_002658486.1.38241 WP_002658486.1.41722 WP_002658486.1.44797 WP_002658486.1.53248 WP_002658486.1.58911 WP_002658486.1.66939 WP_002658486.1.70456 WP_002658486.1.75039 WP_002658486.1.7957 WP_002658486.1.8279 WP_002658486.1.86244 WP_002658486.1.93062 WP_002658486.1.95407 WP_002658486.1.96757 gi|387825468|ref|YP_005804802.1| gi|387825647|ref|YP_005804977.1| gi|387826578|ref|YP_005807212.1| gi|387826621|ref|YP_005807254.1| gi|387826664|ref|YP_005807296.1| gi|387826704|ref|YP_005807335.1| gi|387826882|ref|YP_005805014.1| gi|387827822|ref|YP_005807171.1| gi|11497164|ref|NP_051272.1| gi|11497200|ref|NP_051316.1| gi|11497304|ref|NP_051402.1| gi|11497334|ref|NP_051438.1| gi|11497390|ref|NP_051494.1| 366067 gi|11497164|ref|NP_051272.1|NC_000950 gi|11497200|ref|NP_051316.1|NC_000951 gi|11497304|ref|NP_051402.1|NC_000953 gi|11497334|ref|NP_051438.1|NC_000954 gi|11497390|ref|NP_051494.1|NC_000956 gi|218203930|ref|YP_002364771.1|NC_011722 gi|218442431|ref|YP_002380740.1|NC_011736 gi|219723035|ref|YP_002474467.1|NC_011847 gi|219723121|ref|YP_002474553.1|NC_011849 gi|219723167|ref|YP_002474595.1|NC_011850 gi|219869966|ref|YP_002474232.1|NC_011841 gi|219870074|ref|YP_002474406.1|NC_011845 gi|221317021|ref|YP_002533160.1|NC_011972 gi|221641580|ref|YP_002527765.1|NC_011967 gi|223987742|ref|YP_002601193.1|NC_012106 gi|224020445|ref|YP_002601150.1|NC_012105 gi|224590676|ref|YP_002640659.1|NC_012148 gi|224591502|ref|YP_002640814.1|NC_012152 gi|224593598|ref|YP_002640934.1|NC_012156 gi|224983769|ref|YP_002641089.1|NC_012160 gi|224983812|ref|YP_002641131.1|NC_012161 gi|225576054|ref|YP_002724880.1|NC_012253 gi|225576376|ref|YP_002725364.1|NC_012266 gi|225576410|ref|YP_002725434.1|NC_012268 gi|225622022|ref|YP_002724967.1|NC_012255 gi|225622068|ref|YP_002725021.1|NC_012257 gi|225622114|ref|YP_002725109.1|NC_012259 gi|226246710|ref|YP_002775984.1|NC_012509 gi|226246861|ref|YP_002776168.1|NC_012514 gi|226246898|ref|YP_002776211.1|NC_012515 gi|226315771|ref|YP_002776028.1|NC_012510 gi|226315805|ref|YP_002776281.1|NC_012517 gi|387825468|ref|YP_005804802.1|NC_017393 gi|387825647|ref|YP_005804977.1|NC_017397 gi|387826578|ref|YP_005807212.1|NC_017425 gi|387826621|ref|YP_005807254.1|NC_017426 gi|387826664|ref|YP_005807296.1|NC_017427 gi|387826704|ref|YP_005807335.1|NC_017428 gi|387826882|ref|YP_005805014.1|NC_017398 gi|387827822|ref|YP_005807171.1|NC_017424 gi|410683329|ref|YP_006939494.1|NC_018979 gi|410683389|ref|YP_006940719.1|NC_019005 gi|410683427|ref|YP_006939522.1|NC_018980 gi|410683466|ref|YP_006939561.1|NC_018981 gi|410683702|ref|YP_006940635.1|NC_019003 gi|218203930|ref|YP_002364771.1| gi|218442431|ref|YP_002380740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]